%PDF-1.3 % 1 0 obj << /Type /ExtGState /SM 0.001007 /OPM 1 >> endobj 2 0 obj << /BitsPerComponent 8 /Height 1123 /Width 1749 /Length 73 0 R /Filter /DCTDecode /Type /XObject /ColorSpace /DeviceCMYK /Subtype /Image >> stream JFIFAdobeeC 4"@.0&4KBONJBIHS^xeSXqZHIhiq{QdxC=""=VIVc"" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz?㨢:(((((((Jӣ?c?ҬG7/٭s5'Iy|bC֝Q}Ef}kX+66NñW6:1i 4қQVul5jp5uHEUJ((((((((((+QOb𛳿(~B:;ɂQi.⺔kEܳH)E%(L'f?wzL hp{H+D;KqVqceeV[W\EUWfy_B]ӊmQE"B(((((((((((((((((((((((((((((((((((((((((((((((((((((((((:?+b:tϝ=Z= Z (5[R]dTWu骯M6(~((zAR'?[1OkEu3u)qNOIK"?P(SۭGfqT㢵-ZսxTWV֤s?tE~¯g/Tu9aУg)nOFSMFs9?߼G4pMPP'Wⲵ'f;@ĻRTv͢+<+gCL[JhvzBy$yi#®ZQ pH(]it[ugH/|ŦUJ( (( (( (( (( (( (( (( (( (( (( (( (( (( (( (( (( (( (( (( (( (]0;RUSڹ t~-?lW~vs竀SF~J#L˚ΫS͈#5JTd?qU(Mk+J6(u,kWi9ڿ@:ӯU=Zu2z 5LCERkmV5гmR}$5ɋX𠢊(Ļ}Hʳk*8ID(qM*!VҊYޑUm{_ְ+;Hq4QEpQEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QE獣+M(((vm\j<JQEQFOAEQEPEWQg/coSV^.f JW=(p^E-"R{DHsڴqY̥޸%# 4ƷZJs m0 k!ԣ=TqYwfpUp*QRsQEQ@QE۲=zejEQEP (+N?/Gk /?@*sҫY|??ά18j ?n?MO@[ۚUGM'RWkG@v4P:mm?*tGx?FO?Dz:yyjw8yjrzk,U_[켊p8t~vTq#g@.4=*.|,φ>R{ BHLiݤl((QEkxv+Q8-mjW%ܒHUPi$墶;#[ֽB>-cmGF/O䪌mɨ`!eRx1bBt]KV(䓰U^_KvmF*$iUI]RB<ұƗ>Ӱ'Ңc%4$+TuL+$yҍ;uQE\&jo2$ ϶o'/>_=>be#1Z 83^ӱapjPub84lҜfmU=uc̨FST[/3?ʢd9/<dEJ%)$J+`0z ^~.5YÅY[*_S[|tUv>@Ep8n(t`*SF@Tu+1lt<1qqÉ\R@޾ISܡEy%#tr|`vV%fpFI/Sj1gBǟcQYKDr? J1R0TVom^³o_ϔ\d5H{9> *I˙ts}ZmI,((QEQEQEQEQE蘣IJxP8QE%Q@(((((pLG_) QEQE (( (( (F~ӌNI@((QEQEQE~t*e:/?ʁp)QE (( (( (T9"(B(QE(((((((((((((((*o z2?5kJm>+JNӉj (JAF}k=+;U\'+2A5(P6+&a3GaETu?qs_\tpUx-QELU/voM?7Z_ĉQEJ1R›1{Ia翭O`b"弾OY T^jӛk`㨢EQEPEQEPEQEPEQEPEQEPEQEPEQEPEQEPEQEPEQEPEQEPEQEPEQEPEQEPEQEPEQEPEQEPEQEPEQEPEQEPEQEPEQEPEQEfU(SI,s bQEZ{PcNh[VSx3QEPU,p&d28Z,W1\ִe!+HRrMzXW$ ( 1]<|*֪ETz TU'$+GC: `+"[MvA<-:kE#Yb%W A}AMQTLgADZiFR7l&|')?ַ:~Op+™U֘'c +fnY0kRO1-:MQIEVFEQEPEQEPEQEPEQEPEQEPEQEPEQEPEQEPEQEPEQEPEQEPEQEPEQEPEQEPEQEPEQEPES'қNq6QEQE (wm~:Ċ; x8}FMKokQU30)BeJG낶"i^L(`o(5S*j >G*ID (ei$'Mΰ7"ygԋ2Ջ rzSiWt*}nV殬{]AVi4bpdך58XQEQE((((()S֒?ZQIEPEQEPEQEPESiP7 ((QEQ@QEQ@QJO:M%QEQE (( (t_x6@QE(QEQ@QEQ@QE=?ΙOOoh(eQ@(((((((((((((((m7ic;]O8;.EWJz\?;}iWx(~?5vd#Ҷ.u?dݏFk+T<\u (G*+D_,7Ń݅QO41KAT!]$N()z27UZ̾ƶ_ĉ?{U?2zkL?;Wki*[w2c]QWϟjJ)OJ(QEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEP=>(ՏJҁp)RKVhLGET*2zԑF(֮ W}h46Š( pJkgx1jXab s[Xҹ*9ir:P(ΛO_-.F3P>\ǥol^T}:S$E*=iao,$7 (<ǭZNg83WXjͪ^+*tibݘQEY, W d V++<})ˆH\:~H(ȟx Ÿ% W85gJ׽6;UƄl\hQPC8<(y8.ݴgUgz4SK@ԛq֜]}m'!m #J)h0jpOҭG|搯ȩ9L̬%T Dcg52mLp:ӝTjdA+(Q\SiG=S sOU[cR*&~+)'ji('Foֳt=DJ̙.M8ZKIPtR#Prģiq6ET8n¦Hɩ 4ld'Jr'7~QEʜ{UrGZCcU3+:RhtdQE9E| ]˯] 629J14rc悝ԁMu+ФNmWU_JWd>)'HݽvRSv;Rm{a!UARݶ빛j?7vH2~.d&C:QFqQE2f]JfZD 9x' ~63~ug6౲z|g&!F( *ZԱ]0󬋓NEnD!?~7x=jI*R-< WtᢎՍ~?~jsZ7zqȥJuU_wMU z}+?;Y߹Ɉ,1SQܧȬq;l\,GfQEGER9Š(V4@28R=9gQEl F)4 ^>CZJue&jŠ(jy5י\$l= ԗ+AѨ袊* Š(((((((((((RQ(LQKBh(((((((((((UR 3@QIGZRHsR00 @QEFJ9 U$Sh*1 ()* үqýbH( IdXJRQM*f D\cJXc\VwEǕ\SI ^W =Mܸn7 (ClȍNsZKc aMLFѳTh(_@**ܱԑe= :( ԥsŽx0z#HFDQE":qAQXwHv槕(Z* )h ~a%zZUmC#ȫ 0z'(QKJ_[9D|g]</j˞PT<9{SDE)GD_'pqڥ 2G){&^Qޔ C֞ӂ+ORx{TeU$_jF[hL=wq)E%.qJ9괬:JE%}iUpQ})qKژ'كev6uuʯnj%γRlj~^VQEm8@:+x;! [gt#6l)V(X6wKHCtxsn<.+%mjE2Odׁ%fx5EQE&EQEPEQEPEQEPEQEPEP=)e zv>&YI(e(POʵ-0Fh (w)M( Q5wiя Rp* zl6!ps1U &ϗ'?ÚQC9e7_AMCD>1@aET$JJ Š(((((((((VP6QE8_x(QEQE (XGLңZA2QPM^r9m #>x)c Wa/e}L^raEUFV1T$%H(((]Q?,S+z(hI#udO~L~/§Z}GRu-gL%>֏jvu+le;ӿc*:F V=jm5z}z53̜o%QYTQEAQEOkRMIgm҃FAET}zP4rOG޽DIW]r (xQ[)DuoV9k_Ca*pG(N?>2?5m)Vǒy+[GjVIR2: ~6ˀSXC7pO\aVSMLfuQEQ@(((((?ZJXhQE'z(=h((((({ivy2EQEP (((()?M~=X?18XûVNjhtSNq@zROcEt~\`SZ"+WY-FQEsVzĿUk-̿Yʌ3q(NOA4t*;QL(QEQEQEQEQESSi_( (EP ((((((((((((((((+sM9?%Zi&_ҽj{4(AVTWКfܯ*ůbW(v(? cσQE2?KiRVBZ[Nbտ'zQE2J_ZG)D+ZFz\QS;f04:Blh)k*<`udoD5^f"<^~˶APUHEV'8QEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQA@QET@[8gŠ(2mP4QEQEQEQEQE43ḐkOsVe%AApQEe y 9JyHp 䊯vWD84ښaETDžmOaڥbX2OaTΌr:V)|ܪ)QV6j.ϛ X9Znwh[jh7nBN\]4wӂQEBXzTrseqqo+].QF E-%!'٧y)O#iiÓ-+-TS0T>STr\Ҝ)@ P۲%)(I\;m<«|InQsZ={ JpMU`s0ZN30*sJʟ/S8nDETY2$t(sVO-dv"81/aEU'S&k'E_L~fSl/:N)2.*nҺ+鴎4iZQBǕU\kүtK.W6ÓwbQE(#(((((((((|X?&޵4(Tt梷\f(5[ (-u$<[|B 3GZhQEMpȪ7Aх%XX)U^z=:S)Pj+(arqRJ7XSaȠS]2L_?(KVv#+D1V̯ٗ8ɠ*ݡ;}X*kXWDQE@wE>M:ֽn+z[jz5t޶(oHЏ?v#kˡDqᴫ+Iv}L|GWU6=LҺ?]{EV5jYa?Ļ?uV4|\?Cqҗ$#ˣ>IA@(=)} 6ϡEdOnz٭<gLd>l,#!jmKzgњݹۺ"=OX|0u<M_]<4qRK%}iXOxk6i/u?5OV6efSQV!5&_eW'kSu;hn˸uEEQRdQEQEQEQEQEIJy~QE7?ZJWQEQEQEQEQE sUI.?Q6QEQE (( (Ѵs,HqƳkCkj8U{NS]V UqIRB9K#1*UR=jYgLWz̠z " O>h4k4R5T"T4>_EF)9iJWʭѕJ:hT1F*\;P[ЮP|ȋ;WHʕ[CYڵtfA1yo%Bi)'ŽԔy<(RG'j^BW]X;{V٘e'%)i)GcS:V…56=RnjĒG~N>?J:j4}97/N*'9PPԤ!1},j~R+@+c?(TM wrhRU"f6dsKw2lU<$܇N3?(VғZl4VzsϵAfVIwdW%O, d$29ZQ4K/QJ "Bjhϡ;&3ڞٷwU(@+!xˮ9OCuj*{(OzfiyU4%{yK#.3mh3!|q1;4&,%}qW.AkT_ϥcBrQ"Sq#Ȥ0 dU“fiW+&iOq\zQ[^g$Ps2YMk/&'-qS (21*~M.EV&9>+v6OkoߺzWQ5X`uaݡ7_ iQɟʩջz忕T]=)ǺK޽*JЊ;bGUOz~jaU؅'8*~kf4J(jY5DǮ*ddJW;]Xߒ𢯑t:~?c)HPxԍK`Ga"0ݴ㚒$>sޤqK"6%sژßQEK2awTdnU -B(rn}i $zPM(>bm犚[㒫EE OTjh)I򠢊*{7&UCZ-ek2h֦TluQq(KonLF\>R~m?2C=EvϨg=+kEJ!E QZE|*]2o#PCvE$Q2(BFsB7V'"dXJCd ӌO*KC( >(f;M2FqRn)*]$}Mc6Ld`ؔQEA-fXY}E6h+}I ;I &m.\rOJlV)ɥ)RQڴ6 rHʳSĎO=je9\+SXbUFq+ZqV6//jJZJfů*<;OjU`UU9im#֮˨8X󰢁IJ:+@Q @qI >Z5$˃֙bU49YJ7(M9TTz295WF0ڮX9sꠍ 94WOʭIYP7*qU$ irAVU-ڨ[@,([1YV̫RE'?Zm/%_:nm7*`UhW`UB-SУKWR4ivY[~l A+v$,?CZy:+ےjvm|\,wOzRNQGM-f )9 s֭ !~q=+FImP]ƈISWQbzK_7vGu ֫6Ji\4QEaEj"RNjXO-Xg B0zHY|O|ץ*R%{){SF@ZRkEfm 4K ]OCU[+gO6)\zG> (iȻ 8aVne>HW70Wkwg>^>GE\4|,S$L0i) XL bBzU9d&4jd8 yc\ܬՂ( bv$5i bHl[nY˽1/}j)CUT˰QF 2\5,:LGS…!BFTmB(b $UWkE!';z*(ܚDJ,B({UpjjM>S9'(v'͜SaxMJrGbQEIl/;jEDvO6aPm (*ƻ ~|G)=9>]\[n(QWsfܞqb QZ X Cl%2k%ZJb(=B&O~cioZrW{1њh}(k_ ʑ?Q ᾂQEQE(pu$<pt QEQE (( (( (( (=.%_[ky ݑ~Jmr׭p:p Y*Pq֯ HÊeIQJ#IukUN=Ф*hB (˿ S*OvJ8QEQE(+ѴEKuƲ4ubP=5ݜWC)^TǞOݦ*ՙWl_/J;dڟtP8K1$s^OYO ∹88q34nFTU)ML4yYT))Hy)^70ILۨOG^GLi͘%+nG^ӊR7>jS(uW\3?OˏS7ewCƼID~( AESLUѥcw&=#qRIU85mx2>Ms >0ukK%nJ}>{s?Ia5+oQМǚ΢+ntٕ袊(;QEQEQER_%rc?/FpQE527L}(+[Ef wWvs\Ԗ21 9$ƕ݇yo=19!s!L_?^*kV#pMi[,AOnGTbXe%kDT1 cԕە\`T2хHc$*ިHn˜~mBOyIrݎ4v>i6[[} SgPO\m6;r03Uʝ>⢑6֮(!dc0<+PϖNުx5jtq&AdRtKWizdZAa,WI+*0/C6=nC5^&1;F9*b<=j7 eT,iT0X&)Dcq)ڎRb0E%QE (( (|]L_>> (x$kFtK{UU>QX[c_[QҪm77*HwUdS˷b"PYI}JV皺4i嘓5ƌ8<&7:5N' V#?u\ZbOS^."+D1j%6)A2(>ŅQEQGԧaEQOD$qLgj (,`eISq(5bᣍEnޣ`+#sxtd>]Έǖ(Վi5I;͌dtnoΟt9c`+aeWm@U;!dfnny<'xфŠ(v/PNvƭY^5bAVq@$K..<QEM8.P6QJJ)< S'Ep)sRQE/˸(*[R\7oϸFNEUnT眊 6U$Ҧ5Or=܎+˘(;1ErIgon.b3ʻvsT>r-ƒiR s)9X(EvR~^ndt+=V.M8Ʃ`Z)QEtؙ$Lrv:V _$m>y9DC>T;?p(r##*9ec+zӅyhuc^{RQ]$H%Nj,B6lRY4-؍9¯_FcHۆUߚnȈQ(-C gloaG?J4M ؃Zn`/pƹ>%V;)&kk6ХVCD'X;SԣW\5U├cQ2}ol:=yٕ*GYr JG1ulBƮ /qS&żі6}Zqȝ:ErA4t߆B~ FTܖ۔]4!>R4GOȤ~5Mn!+'5¬d剒2WqyQh@=婫槰QT5JDȞUgAnOqUWZ<՚ (i+܊=E- jSc_(.:sTZ޵˄ov!m- *RT(SoUx SzY"@O"EmPQ(ݑ%vFNmTvZ{J7Tά| #9bSjeU$>4G\@4yXBz(ˌ5ah-`b6:U^I2IȬ!p2mJJO/ R:a c)tF54Crs]-?y~5c"ۖoNRm2I1~v˟*o[qU ?*#8kE%J?d@RKyͷ# J&يSGk/ݘ;6"5v5Q,*A۟Yؽ1=jqښxVRߘMI-?&3UGy ͲS=CR}jTöN;Rer~^FjG cʞR܇Gvq ٗLƌǵr:fnQ*pEYED}G5<1k UI˩ N+rXDUPZ_^9ւ/^NM5Ʋ^cTM!=X֏HGG*~t4|>bpy9+1NrQDDgmZ>OzmPPVD_Qb^{I2 !pGݦRW5 y8CIE6bŅQQ9h8+SFv*0lXzoV(duKցcRAR!EUqبXE ?- -qR!EUO"Eb늒(c ҥ\iO8(nT0AET-f kRi5"򹪍8^4ӺAEQ#yeEWH\*x  ԊmZ_QEi.V惉R_ʣT[;JMîږ1hQEhxesGWC0sx+{dSO+I~Gi4;lvΆ҂9B[Ҥ|n+٧zZbo'JTdb1M&BhiBgwU xڪ98SMisNhp@/AJ5b)rUNYkҢUNsUa+#?_~t4R{g]џWm~;Oy#[媘Kڃ@OȼS,3Sxcrc9?VT1ZÛ+߱MngR|gA ]:gVң \W?⿙|3LW}fQE?|3KG<5[\ETd_KE<5uGZ>[}rQR5 bU>4FrGZWF"2֒ՅQZ4j' QX-%YW5jVVqVνHӊ;'VtQEC>}͏}?QQYj3(̏x'Ə1?~gh=i GޏVf?b-QRŘ'1XS'ju}MJcEL+Ղ匙PZ6QQEQ3)MYN:qyǥL}YI5c hOtzSB֌6*ғ54?){TA){SXɩ FXvl#gO oaR5+4*rE4()cGr&.fd!CVfMOZy,mmnOYu;lV=pΒmţC8ڒU#^QEcxgoΩ`():=8>EQEVs߮ĸp( o_\na SP'o, (*Jud[^,{QYzToU5%&>ZmpW=/ kaETާle_aP)<$kI]9sқSZԥ@j?y`ɦ< 5ӂQ=XF%K5uVUmAlV`A#*ךڢfA)Ӧ2Py5`VͿZNrs>1 SXG]9RhJaBrN) Gǡ| j)V2֙~i}FDB2B˃S[Q1۝N+qv9V`{XuC0"19Ynev¹*ܬ2I+ZVgN/b/`dҫVLyZ袊+vlPQEQE|ɫ0()sǺ QEQN-KcZQEQM0()sF׸]QEQYSFbDf삊((Zv =Š()QK0U'U"׺{QEIoo$5iY A޴td@IZ&HWNSս8^mdU&$2:W"1@P\mh'p4]œcAh5,cw'[>U*TPӞ^vj*TeݫpAEShi *Ξ'ʒҷ5XYd[Tl#D*u?uԉTTR8=C#lQxBB{թq9<a ~hJ\p)(V[Q=#wZ4elnlWi@J'?Z޵7U ΧIJ{F 2d">pq*ݢOM)2Wzo!OW&,-9g J)){V=fv$3NP<J ϗi.06Z!WtQct,iǚ\(sVQE: mǃW-vխNҸ0GUu*M=l=~\SӦUg,!- plg#5,%!?+$*^͹y 1;FlvBWXs3N#))F1"b1# -=}h$b<A{\lt UB5"j0N:S1rSEruQMcxPLOjih\Tzvg(8p*-o'O?Q\ا!Vvÿ#OClMn5OIxێAinTM7\X92g g3,ɓ]\9U#_=sߚ&EQBui 1P@>~W#iUMvpawBRV (!txAgZ/* +ap|ҭifL烚^irT^^(ʸQ!8V1ՏE{WEC?-sp@K#i@k04'BS3K%x5vYA ʝrb-8kzRš6ʲ/[4T1 Wjp׃䌌`q6[d+گRݝΒ}sZ+ `nB1d$5:\dxb'D#N\_!F|.➵-?zL/u+\ͱWߡ0sZV~~=G 6upcX~ZP)*~U܋؜ƫ\,?)*Sԗ f&X9QBQEQ*ZVZ1mY&-cɤȩ H(EÔϥKyr9:IAORF6m =QEKl߸AT0CqVm'ҡ*Aoݱsw`+4)=xEvsӧZsF݊)%19#0)F|˸zۣ4OҬƌQS"$c,o wQE '3)U5m%as֦c 8%p? e]{QYrzQյfRdpUC49EQE20}(*3&s(Χ >kgq\q~uQy"[@uCa^5a#4;OQc~E"ev&-SɩdsQӎK7d>U},0OjfXX7)⢎kfۗeb)n0NewD@=BؚEj 8ev H~bVD9qs%ġUmj3G8,dƫ5EcJ;+ YlŎMR#>OAZZS Ecl}^Ndڣ^'x&oQW ((3()ѿݦӓ!Kze{QZ3۝CIYJCZak-SöK0:OzdlUx:r.i?5!21fmo5Mjw&)bf=ɫf#Tl n΃+Tk զ(Sh'ɦ,m(L*Pp2M)T鶡5c+ҜNѴsUY*lՐ8#5UڋFrU2Oj"ѯDj( "W*%M+ܧrVl%KpIUn>fnG9EX>٪̻n$JYZѮyɬ>uljrr|u_/A'l1~ҫTMv5 QEy 9˚8} (*rBtaEQEVӣQABŸ˗!EQ[:Y-dEcVȑ3¶SBQ3(Gz tQEV\H{S@qs_LM֒M-ʹY(B*>(GS0SIL}EPm?÷W9[:bT^v5ΣJcvD6V NH}O;m[^* (䥇#y+4cEQEf*R~] AEQES5'X9%-9lQEQEu:p=Fm()R=XG((S 9{JDQEQET9)XQEQS /$<\(+WCJdoYUx}?$4p2z|AK 8H*arM*7VӾhrw;-œ1GaO"y4Ffsޮj-#6 cMu(V̅T\R@ )>3h^h|j WZtLAoCݹZWft4z/TvhT&Rf=BI^x5oyh8oNSeMy")(Š(*gkZ$㍠SZ 1p(4YRJ*QWM~\-ɧڦRh>&a=<6 7)hQ)EM"_9a խ$BqP\A窎[9S,z5)SqKqFއ" 9qġrrj)c/ʃzL1v󊝗0OVlgQ/ L)Glp{g22^VKd`gn3E~X)`՜_oZg_֦4!s-cF1C)GZ^gT&]r;cj.3Jݤfe%Xm WL1Q<;Y)ѝ3G]QJ/[skN~Szu̪ڸ ۉ6~Uۅ{ԉ Y!])2~sO)OɷB((Ɣ# Vzo3UczTfmG'QW$2:u@2rUZWB!cSNA265vI 1F)ncVSTNs}+A枰.2XPс5<&TR,J rF➁Zt^h;7zԅo$x1Udkv'%sLV*jmHO, |oDm)sR}iA*}RΦףC|)J.cG(T59Ud ȮQ)xrI^lX~цV.`bNG5c09X_i uFiڻu hȻA* `ذ<o*ܜcwTTfV@halƝQ\i 8-jrOzNџM%$$Ң[&Pw!TiR7<.n*2OޭSaP^՝J|=J\(4xZ%,HB79=7'Vu?WL#7pӮQT֮F'© J:Ҏԍ(_V*cVz Ӗ*QhXTz:#}.طDbJH\Zz}E(Ԕv^Qڊi%Q0OcMXО*3ּɹ0LLCхQPIaVKW޴<2ޠ80+()6V TT/5Z.cUjyUr _m+6iB>1iи'|nbJr1Y|s+^ơY\m1Md+9U{ n3Lg$sQ1@rqS+A{|,́ɐy晖QT.(dĬ{28j?¦9WP9"Ty8:HbNr~58I.W#?QQypdG#)QHOpOӽGo'4lGR/+>H}y^k)bs4+Wql0΃$VlLmlL~YQIT ]Xx$Vj٤ik1Lu?Ӑ2bfTSi0#JbUW*1P(*3ϭBCn_Z%TmS j]-w"tn ()d^>M 1*xB?0TiI>XB(pDN1MȻJl|FWtgQhg.P+!⛫G |jW#=kw`ac.>U+Š(u{2nJXlB@TEUkc8irpNː@tsRtB(Ӎ/5'لmZ"€ҧVQEeM`2UC n*Ojh3sG!B (o+poq4kuJ{u' Wghr}6̋Z!rZk+`Ղ0kԌE1ՊSc7%h2R8淼^b뵹"v%֠=Kd̤d($"biY# i~o ^]Ƣ ڃZŕHǠ(v|uomVdx8sԏdAr8 'Zͩ2OE^T5\W8VXybs (:!_CoP(+nq\()_i"m戔 (ƓnK.{J+MNEu6,,xeu9+L3r#3NQUݷ.HjU@&iʛKBia#0cTpmtbI2pMFA1"6jR?Q3pr';x9hGғ\*¡'MBUCH";}JʻSP ;Trif<E6,󚑇˓MAҴVDJ8sWqٕta3YAb(O1JWn*(U?<( WlNZ/E&e8Zh_(|犣$|x-95:neZH"H\ ^ͻ'Lr,[FU}6ShCr|sz65SGj.bW/APRr4 ͻvQv.Ŏ? mQG~(ӫPjVхQEQJ>..e ((Rķ M0(+N[\((_X,MQEQE_TomŠ((Z}Š((/+a;ZEQ]>4+ћvJ֔aS=i=>),)obpjhM#p+٧OݹnFW 5kJ>B U%֜X⥖?+Lqȫ_TbN6껤^N' QGn!c偕54I鶶cGV V_yUrn~Q ;y{r9Fl zR䞧UdTҿUU?¦b;z֡79';|'@%w=B+ҙSg8\TҸllp44F^sJ]|Q@IR U9/:,ȧH#>zr d½8AmKЅC||sTS9%jŬ(6h$er4MrFivڜ)bIíN?"Q@Kd芼NVCjM"I;a'vULdWUڝ9tHXm6mmH֔74dP3[iUe7'N>>J¸Wfʢ>5YR'7aB"=}=wnyH#CV'%(OoJ|^UI8Ҹq39NTSj55^1UI2ڬ&{UX:L+-!FG"*%"ҝ ;0? ev ϵEI\ƻC9^*Of` e#)ۖO‚ŻQN!Z&s7QEcS;4KxVF-j|-Ub$AWC_kHjZ/\Uy?Kj EmP*jSKIގƷ (Y桳?Sk OBQEGS< 5vاMg3 յ]/"FCZaJ))EH{qF{ivŢCҒY$J: ڑٶWՃ`i(Pz`&9X[7SjL溰7|A[ZeʀxZݐy栿;e\UbIZ:,rmL*0Ez*[61ߕ=vLWZژ\0ZJQ%C#ъ*j[6}F0RV,[nyr&OJ Q _v+ٴ@jj aS+Ż'ڒ#;s&pA^-hfpȐcdOʧ?tּKH8-]Z$e=º<Ֆ5Hga9Q==Jɴ%V?w5OS((<^Kbge9)hqDhs6L J붛j6ک4"H{W<>G3* ( jr}ԿFET&7#Sb9c}9D٧}~%sh˿e.hd\gyZ?ZDr0&j3~u4Ŀ٪}=}Ɵޟ'4Z?ZìIcV|<[˯4lKx{l7y'G<O֨y֏#?/#?/|g._˟4}c >/mo/cǟ?Z_Q8>s?fyG0y!1ߝc}:>?<} H\gӃv`׹zTR *lSY8)iUzf;Q6SEFUO,hE;󶝵wdir}B҅(2l'hkmj6UN=DHvHYp'M>cS~nj"fRxqu6tE$mmM1{Ux%d,P^#jXW,~7NaII=*nR:(C J˅hsGgyv?0F66Gƞu?׆Z\aGJh=hCZzf;}w9t,ftBXj yttUb)*P8_Ӎ(Ӕ/o3gȒCt&,xfeBp=~Eeká#g"|asIϩ}~,зB=&V̩@@+6?@z?#_T_ꟕf[6!94I W׬Mno7GϯʼnϷT^%gQ[? ߿K.3~tU],=}&DJ)YW@4?MmVl!hdѧcGoGYVhciM:vy''4ygcFϿ^4Qq꿭gQ[QhRafiN8.5K}<F[>|?H?ǸZ?=SSFO[4ӡt cyi?NIn[/Թ]=hc\Is꟭P}MIt2ĈP( SHUGgy6OZSNNc_v].hc/#ƈ;T^h$tkv=8siF6=jp卑$ UUxG ҥ C|ݪ<)8M2Sc)y'5.qWFH;zR,PSG94_O=/gF3E¡Z™/3f^㋙D1T!X0?W8*o=if?ӏm™/2fvO|}W+,e\'Isgf\yO^~G{'1Gy4hz._ ,s蟝'UϢ~uڮ?_/i ?l-ͪI`{BߴUr-#a]8z5Vmt?_N4xU8 R/jXaDId(N`qQ*jcQ^'cׄ-r[YiF޸R#8?=i6v EiG"zK-oV9!H]x ϵЊ?dԱsRb'ϖ*9LŶY*:bNxNE2Ir?ʝ+%[}*ԯ#2:ו›Q#Z}@IU%iov!U]K}{֤b_jw%ڗ?J<|/i~ٗ_~tf1_kf?/j/F/?֥^_jjw/Ghf?֐#Y_5#T1{֩||I}?/S>Os<Zw?O'j/F/s?Fo}!K}?/>s{K$Ϲ?}~%l?P3{>Q4v}=iڗ rjSȑM321R[WOv:}_2[I|\9e4׹D)iv+cb*(a'#҆8=i9B{~T⥒ΏjfiJ5)(|2i< ZDFj W e3zWryG) $IVZ1b!R2;⬪]q݋yR8J{J5eHzm ?ձ##qSğQV$mUz;POZ¶mkuD#yXW$vQJbF3 _Xde+dG<Ͳ-j.bX'<ҭ8S`̺r#;mQM?Ϲ'oҵa@JvWӎ/T]Xuqx{{ͯſ*>q<_C{qrzRj]d`|P뗹G/u?G3_ ݐY揳M<_N?Y?7ſ?浆w4ۗGC|T?þ٧/|O<_5gNj\zG|Aoϐɤý n'?K+y'M'/տK|Q?"?þ|{/|a]{dp<&"_ɫڳ84kM<O-tk,_/ozE}>GoOɗy?hdo|i?OY/`c 'Et^ˬѥ=cY(8ae?&OɣʓyWF/?Gs7e]K+|Ǫg(lǪj>CQre*O[q&bGG:t,_?[ZLM뵕sXrDs*Ĝz*S+BW~hndQTCgO?\#n9U(ރU֡iqҽHMXcz(5yĄ5n9`_~ZIL!ydܚ3)TBԅɦJ&3Sw-3ŹHy}j3 *9ow XHigqޣiMB曽]ci/#1*Nױ ,`2)b}rj$ӣct|=noU-+@֭ 's~#>H/mҫ= Ti*sWlb?0zDP}GKO&eZwsW~VӈRأCE_7运eҩe˪ßd(]SK"-??&}?'~TZ$9U-'TW7VS'{x5cs3H59HOJ4ȫ_kh?J{y aʞ}WuȢ8F2i[7+؃lz1Wr `f$MP@5z;@3?I 9s)}jBUsp[zGxcuVxJ7qU^꒏NNpv.f$ͧϻS2(#;?W ~)QnqjQ̥E]/`G8Oހ.*;Cc%OF'Y&LE$LCU=~8掓m{Uֈ~|bsxUB:4I%K}i)4JOuSB j0rM6E|&H׫+GvO Ңm&T-y/5ZR%VS(}B~vYs֬ߙ___/P'waWԞXrM*%##ih#*'QEBFONzSbP"Êp\0Qh(ȼbeGRkuFQY̻GWvMj%ۓbEM(iwIt^A>ʱs\cꅤ4-gQrbN* z(ZYo>`OEh/oJ:;t7Mm!VVQ{dQ[=4.A]2d) _o4.J4VwOA]wdjW5֐Nd7hUsy?#TяKSC}܀g;Ht7)Ej`y?#Ht+1]nyH i>&֗S$ ^=Vs)eZW{shû5(h*AUʓz-_k)~ʯVG%S_`z?K?7VGL~KLlQU>oʏ~UnK>OFg:oʏG=t})R򇰧vQޝETѿ* ѿ*ETz7giUOT`z7*%/QP/UOG= *yTn6Ө`z?(]UG֏QPn6Өf/`z?*GCRQhKEU _Tùؒ64NCc֪jPqJdBmF0sIJqIMqq][oN5˵M-p}j-U$O6pDTR %:+h İ "[>%ኳFwKJvO=G7;Nq)ѰٯnIӚ駆"4:puW4lɷiqRuCT *AefN7-{Q`7BQ)Olī֝2wr&zONfSVEx1t\Klۏ.|GqV<)G-bphڴ_Vg W@Zoy9 ȱ#TM봜N ]f{V$R)⧏n+9OX>Ul-OsM^W579p=*T\⢟֦Ws 7tC+UsqPCr2-%~{?j+fR^uHՌ)FC[ֈI_QGQluc}k]b1έ] F1O?U)֣-VFMuHsQU;?NjU2{tHODiSd0QE4[DX[W))^(~_f3J %BðQE"ΗqyJ4լ=/-R`Z(GXj_?cORU~}??O{;GZO5Ef30RRR<Fvr&sʯ<ԩAq-S`)?DQINF(ۗIZF&wAJTRQV+. @QO^xYR"2\rV\L5nCW!Gᰇސi VSҔ`ke8$g^;)4y AFsB+O H暑1<zr|iSޣ 1uB}khSškxU}=iOK0'P#w*۩9\j}<:ݑۛ8(d>>¿4EeFYYcOAtqV)I=_}糱p&~~`jwct⍠)Z>3M(p1OVdq6CY18@Bѷ1#皛1Bݨrw-*T,J9]SJ C࡬QL3Snj#&IПJ3$yX|ry߃T[T]kMdжEVU+5w!܌Tw ^u8zIXQE؛z/K&|ե*˔ QKں~I0*l_&UJ>H=0*؛z/h}?#W) T˜QEP6'iRգ`] %,JE8,zosQ,=(+]*p(tIb~z {Ec= <ӀO~U/BeVO(iYm\vZX݊z0 ֳ3徬(H'2CJ PTcʅ?ur*͜O˞EkVkkB)3zwzX{v)mڅb#+U*ճZ*U- G^i4cz],zz4la,O4|#jA4 Mwijc뚍`1kHEfp̹g'= TEO* H\w#P^W˚r^ bv (hѺ Y fV3s)R(qb2H= ޚ;=GcXĨ$ࢊ*/} u]rcv]3atŠ(ey?VE?ûա(i!yV%Qp{V٧F&)}FX(<<({գ(&MU(o(H*ASGom*SS6T̘U6ܭ}_UjExQr3UV M5PWSv[V,cE%[QJJ0Q$)"\O>[+N ֫^+o L)m˹zB{TDZN+/=ɨ$lj'QWqN\QJdLsZXw𼎢~}E9Sr7PJ%jʞj5=}+uАҠ92dJN$kVIg{!d|0lNԝxؚ2v5fvNۭW* OZSFHk?9%QY[}M?QXtѓZ>SK/aEVFhkI/aEVFi7V8IG_pQEdֵ/_J_R}W(浆=ʏ>g(SSrUSUڪ9+JX7W֖'pG֐S})J\^=x V=Uݜ[o Z/Up>;dax2zT~VxظԱorAٌ\T˹~S¡8"a}(ɩvR**zd ئ",3QLy*g v#<^a@k?XR3H#(^&7 TgR)].؇rʵPKL֙3,yq(\?Ss︔QEff1G<y1f/KQY biOIu`QEFO5sˏRQZU@ETw-D?AOt 1ݩz)+?CЌyt7!~iR b:?ҡh~#sR>< QEWOI})Tpg ᎐9֑(mrfZF\Jָ(8ܼD?h!k~>EVrjͧeZm~fo =t95-HN25fR\RSyW+=zU@(k(=P.>$XTg)AR!1J uJTgoZK"Wv&dWVnz+\.Lv=MC J7jF3?Jk6E6() mїnmv0IO d*D暢*D`5"/ɓHF;Ӳv*7Sm&Ԫ&Ⱛ7os*5rHd&&$/pj \4{I%X&%?}/W>TPE)b֯}пGآΏUW%H1?.?:lzOD:JT\Qߝ/oέ}?(Gkv%W͓=5k1*>굻U4>mtK=_5c)=+=?ݣsxtm&F3i?S}i~Z揫ʯ?mmC'h]K}+=>?;GηFhQ ˑ/fĿ٩~;G=%?c%?/=3mj?]̿٥мN|=<]uy''O/j=B~e/K?4}T{,Gr;W?/h]M}iiѼ??oO'z/GO_gM˯4}~fCѴK},r ULVRrW2&'gUNNgv;CqqoRt7d}EM\ TdY F{]ֿqԛ%oEʬ}{©\!hH;ԙe_~}b֥qqe_揶Ok|K~\Z71.Oc.FIELn14_Po'9@,f/k>4n4T??K_P ){zϸ4UyT;֖y']S2SKCW9ێkx$6VᾢњJ)u7ĕ׷ car?g9ol-G3yyzbۋ3IEYUx>}I{>lj N mR?^]my%UBԝꕌٖîG~_ S(Odr43c֟׈LDUV{;+rcbˊCsMS)1R:[e=n+:ZZtPȿ7sҧGKSrH( Hjr)uH<cQ 6 K +~Q@`l幭q< Ցw-=j$[syHҩm]-\W JEuʗ&=vkUU"a*j7rHTsRFTN-M 30jiXSmbSzZzDjgШgSFyS]XPҔDsT1!<N*/~^:⭐3TsєYcg/%>cݕ36P2<-eq[8Z& (>҆GzR~\-Tc *9'ݥcڤHI?LE =#GyhTQEċ\vڕN9ggNT#qO]:޴3J_o*ril9ꧨAOJVEgЭs~bCR=F{w܇=Wֵo2ICN3JQcoZ~F:g>5 7lBrHT7n\U||{}k1ݝ1=!&F4B vAA9<^T󫷩J,<s=M43Fj`I98#uZSOښ՜N~g)8F |%-$*qӷ\Sox=(ԃү\c5QEf9> (N})x#֗.*;p*,"}=Jn" jOTw!OU]K(u9#{ IE1Ȝ4㷒Yp:UC%ڤƞܪYW2W;QE,G3>hQ<.2P9TsVTwE\*c:(\ E+5J8E4q>}>KuDR"{khekFo{= 2!J3'ҫmF9Td` =O V𱥦H)S5 'W- r+zߊo6ѱLi:JF@j3MHv:tg}]LmRB?&pdb5-MVcRۆݒjGҜiJV'Jߕ:?4MVҢg7p Z (z5l5oa)a# Q)nDy#.MGElUY_2:pΫV0̻ W/V$F UHٶž*F5(íeM֑2Զ (F*HceV-b-n!~),RoFiPZۭʈnQƬ(v]z%vZbE)h=o)c'Zq?=6^c *1,u#OZc4O]h{J)yZL)R.V&ةFW+#FzavQE&(4 &!y*vfr^st:밤w )i)?wUUFx`AhUIZ"R2i MjE5JU5_Eȩ" Q*)OJxޠl6ZՋjvZ]qPFx6OZ,MzйQ] Q7zq Mn8niyvY$1M323ד|qO˙/y|ZrTOHsY$!fUW8< 4} pԈQEKdm. c#R֗" lQEIiYA׈4(*{o6N-h鈒*)Tf.X* (?զW%!Oăw>e ēBWN\ڝ\ڡ4 SZNryMn4l,٧7hŠ(P)R`A$ HETu?JB}Nن_GE/ )i֎:tdz+Ս;\*IE+!TYTޗ|d֠c*eVc9^giEښk0\)MЋ*DA"\rsЊɆȪq aF .qWI tO v b#+/b/Ͻ\fnk3qYI>@iLciXQJuSZ|5RFW)ѓKTeSR'tTLNh&R_kcdJ;;jҳrz*9}iw9++\H\ӗ=qj&[5!POSRUhaj]@ֶQ%G+ #.Ur75[1Œ2i6xE&j3V;fā6gL}v(<_Qh&jz3Q4?S#3I2+6h6ḫeX\U_v1d^E=$pI1(M3W_Nqү$lYyYEwظ٫2(ː8\F|jB"Χ ([П)q@LjfQE'9\dJ$f.zg(_o͑ހ ('ݎ)6sANNQERF)ٕ('?&rs~TϽ2PJ\ڤQE=}(Tw~TQE]s9] m0yIu>°ᵒ}hZ[ᢈ̩ a]9Νc{jtz H9Q*O4yG X&e7$1 `#V-~O;UÓ8U>h8Y&"XB|̹kx6N]'ަx547*J jpP˟kJ XyסI=]?S^U+{i.',X-P:R=m՞(b5増,_Nx`k wv9cհv?s֚]Uy8R]Z)#&w!~J:kv3q4F*L?!NOz R_'=G;~mƥk{;%Js9F5. d|Mq꒖Zo\kbAha>!y<,,j+3,uT'"uhϖ_Lv5 >Z7}rF + 7܇L mNp 0ݑNTG!y;|\?U@ eN{UVjpe;YH46*bGqRrMGUH5zL;g5'#7I(BA5qA+,yPZɶnﯮk7 rbFUq@s mc֑\i8YXϭhebfu_j6[6=Fq&ל99;ُjv(TGEh580G $vjS֓n+k5Zt/呕v_JegʳwgYY͹HYRm2 $ȇ r.om*ʑЊRDy(%[W]qLvh'8yeR7 Zڮ,=}+Riɾԕq zZFh.3/ic,W`==jgn_=*UrG9xiH#$QE+n@JF}TNJg Yp@/z0)N=Š(j<UkR-"cɬinsӍQEnR8wRB6AEQpiqZئQEi(7QRF' ݕ-`tgj`5ۍ[ԭH'k02^V1eEʾY[ZY$K#㿽`Eu1<֛3@wSoCjD%WңӬG)sb#p"kp6jf`֝9{Isec$rsƲ$3F&{)ؗT"2yXVzT/st }>5eUʀ7('NNҞ3G\U%MUe6㱗cQڪEb۷ڞvqz-T\ERH)h QJ֧ 9[U$i rHM*- pv:sM O@MXYg$|{xtO-.N=qurƫ~QR,zd$d;9;ҝF^}:8-Ns# }{R_rpsӏ4JTTcsDzm6DvrʛMӷjZnReʌn]S)rdL_BL?_z(h'L(c/cȡNx4\0heGFQEHPO :(\L}iRAIE=NxH9U:BX ]t\;)y`.[_o?Z#w>zi̊F-9FS";f\nn9''yߔLu %"w1>8{AǗIZJNzh]CQTpS11\#%+S翥6)u4E.r3YGbbQEJkD$CRz- (Mn\BJ#BWs6[j# 6zV09B(OsQuP}*V9o i)i3j:qM$ήO[QE-;4ܱ.ܨ(r҆J?Ĩ )~^{T|ХQEi+.3K`#y=ƣN%Fn ktvy_cU覱'IRp14}Icسh'M(\֣i> &QEh-I!ER U c֐3ߊqL䮂(;ʯI:GNZXGaLW33?Z捣qѲ (eEV墮z"HvՕ"U\-u4*{7(y\|Pڒ҅m >4l6)8PEǯ"caI(J Vyʰڼ<[HLT 88ZlQEtPiL(3sDw)7tfWjx})klڋ{Ir1J^ԔQR*)\~bJ*śyrnw*ŭ qVqqY˕<֞zӉ\qP4FZ(ŭQ{#jX4h_ZY2#6R7JYq֣yj&`雱j.\ikv2y Wjs=VTQ{Sk̭9Tw՜;Ȟ[䏧sUBGc+"*^*}Q+ERF @ #?XA%i&[=Yѕ .mB(}1'\uQ$[w|j\arzbMYuQEޞ`| [o~_Y%?i&hEU>]>xV}/`v1DӍzU+D(t4QQ>T sպ~ZlU4 J(=)Ji\s(\BH#QK^ӊ:ZZAҖsT|نSٸ51=\9F-AڛN=)?`(cޙ-apwýF>4cxl59d݂("'R1%irq5P?/R[1ɶSmQEY|OLdu.Kylz݆#ҝ1ViUS*r扬&.h>'v=iVqUtEI 2) _[EBGBV]sKJc>SGjZڝ-=ֶF)Cl* >3L1zT2?lH[)2j̡HzPr|"cv5N1cJē-el&~UֵMnA*F#]8*Bu>Vy5*9Ģ(ß~31稫DqQʛA+,&h>KZ'B$6\RZn4}yOwfpV̆RbNDx}j$ B_=襣+Hmıy,d nQERxYBjVJwB- '"`y?(f9.QE88niY}qCASl{V塭6 ()dR=(*g,*Q4*4N(|nѡbݦ3+pӵ&w*{16K @(uO=m0jn6HLaN{,Q1 (eh4Ljc3/Ҥg֓qQz=-(Gu}3ϷjYbF,ı=vԬN +?vu (XeOgJ#[?0*5QUl8_ʤk"'98D[Z}VQ*-3( QQ6Qozlx3q0r(Tǟǥ*ݟ/;Z_J>= t(BWp"21wZ$* \wJi2W*mi?w4fQE#4e6M*:m&$ubMmZtheWh iE(6~nmŨ0唡y8lU}j6HwHUG&+)zMg,S'&l|Ȭ)LItib$[ϩZBH\3\cypJU:12l)iP>U$VŠ9ɤ9'#)sNw $}QEi麙3=WW,`MlrJ2x>\;쥊}Ex(i{G&Z?jۤȨO:m>)^?Τtg*1b7@f NF*2ci_E*ȞA][Bqw]nyY#B*2;aR%3Y#A˚uջѺٷSQwJ B(#ry洅vB>҅(ڑv݅Jޞ&pV.ZI#2;Pd?Z6[KHs׭s>Y3Q/CqG v])ؖ@|<.G'>k.5Y]Lmt\gYhS`L1۽y8ʜ3RoVA}t21;D`9b"O~O:sp\pGA!֨4Fv,O WK0ƭ<25Bwgn_ EdUl%$h<>g֬XOjkFw'5[ډBP|Vh糚GLu5{=)~S*aF;U|>Ꙇp?`kTorŠG4#`Or=y庘<^Zs$ c 0qy3}?7֡(^-:26RYF6s):ϷJD}sc(s6NrHJW p:Tllh 肊(̝Wּ+QdeVUn/֪tQRRwӎtPQEZaOHUQesVŠ)FlusI@>9jTu `T?v1[(m9U}&wEk!_R6֣G#Db;;f ?|e:tR<.2*pjZ V# Bt_i]ǘhWigl!cҕ-)s}-SJs%gw f.<}/U[[tҳ'L4_4mD9?*59=ǹrO_QREԀ*HjCmrmj2z7_^q,VktP>}Y?5,~'OE(hP膜!{)r)pVEpЄ/QSy v?T&9 [o~Kjnzz@A}yWꆢ*TZ8BU۷L-9zON\Ȯ~d.P3IyUn{~֫62q44-rM6)h=('ъEP94妯 K4(p4>4ej^QE0i)}kHH)٢Z԰) JMng"rԛQSqQixⴻ4QEdR*3E\RmRjv࢝m#FWMb 74홦#yl\h;;ⓟJQֲEQE ZZ\֋k) iu)ҎjSzkQE@˷}^ԋX2hܮEPO4/֚9](ܸjQE!=֎rՔ (p(=(=* (rRԢlPQEZɉ)HMF|S)sHyZ>QEIRG1HR "l1ϿE,"JR2T܌,Ƥg>O2u.ZDGӼw%XSP24lθEQiTIYj9%bnWG_MD K\2^R *Gb?5.(=&iA9-/QB'$}hSh?}/QEF˝ۭ*|9\t+!QI@IOPpՎ+IQR2^ߝ):c[A+gqXٚk (Jぷ8sQEnLԩg$rq֥}^(>7o#5 (;N*iʹ9#Z*mŠ(c4 \#+nU;()yjQ<.1NnwEU/18BO𞴬o#ھ QJ{IO62r{ve80}Ӯqca1[[+H *7! }w8E]NQ%u4~ L%Tw$S&{ i]I|Uw[݆LJg g3+kWVCcR]5̙?*/Z (R1=ѓ _Um%g+w>(:Sǟ qqTI+&9ґx *v* .O sڦ<>R/ {Rr QE.~ZJvaEPvnM5.$QE9LG([$`M沞 (Y9D'VvN݃z)qޓ-%_%(J*Օ" d#}95zX¥bvO'𭡆Q|z$gXi1[r855qF|}h֬iTq _jX~Exʇ"]<V'VՓBWN▓"B (sGZ^ե (zpQޑiANQGzp[i,)Uaf*wm#o@~㑅=?j(50fi6W1^ZU̜c>G؆$V+R\>͹9*Ət~3WiuwE)RE%C+HѕVQ;w%E1O%METMyRѬ! 1onNVEF$Y8>TtE%U[ e,jXe1[v|AT}?)ASEzՑ܈;QGj(l|0I5jf3Xb2 0iHիL% EU’Wdw(;s@ 7˂`1Z2]ʧUדwY^{tҵ%W ) ^-hA~8 [6[<<0jKQJiP6W232b[DE>E$-o^Q/ iv2^IVV7*1\=@~!`L#=+!n+.zU;Ki. UBvjܚmػbm`Y[ңB3owP-}qS+fuvTI+ۑ[MJbYI=j}V;F?Z̕ bOY,^7cݍ>MY7(\,uY@#;MtHJR]T|\S'X I'j/$§%Y{qSHccS|Ek4*4i Ͳ@qUva%NIyxna4d$UQGG%51GٙvNE*n)~T}MAq{oo"G+*r+N2IaaW5TPD?Js3+Z^[[ YW{?*%$z{e.ZχJHIuXh#{[r]-(V5<VX-SkU['en4S #d ["L:}ങ6c#+زV.ȦL0___"&iTʤ=jElʾLOc$wm)=*4yT9.rTE=³yfxݠƟcwb%=JR:\δtRG_>NMJ7?w ptb$dgD,X4b[B͙ wQW<*ԏRkeuUs֡6,ʶ=ts>eRV6bW"4Fq^EY?Z\)As( r|~r99HW TQQEAe^o(U?pt`7*mQ֫.ZAzןӟ(eݍ]WONGqU;?LۀkKJh兄ʍ"V$Rk%ׁoK*b)Z2d߮:v`l6S7\cSnߔʻx&#PXoƺ:}k$qv6S})]Y5[R~ l&Rz ^x2|VmiDG_XyI2V)l+a][Uo`a^.Q_bKH~ՕqnƷ]sTE/)^}qVeOJoFzl)³0{+GN-5+E+)F(N %YU܇ЎWndO|R4=)3)4QEh-i$F8e 5CMtw0F۴9SuB<}Y-">OYrZ0vqukiRcdmk(Jpy؉a)=e'&2#wIDo`q@GNk9F"oCA]L2MyǦ 疷K0 ei,RB%FFF)sY[܍#~5Jo (N5I5bʧ4+9\ytgEO{ vrHبoZ)PЂ(2ᨩ&m[ {F2e8"KRM\YW (Si֒K(|g姃LN Eid\^ETJ2/u\jˌيʒ>4wsFCPj *ٺbIxb{,h87RWorٿfɒ]>3a¡aUL w]@9zQ!;*ҦqIF[Ve'˝m$g8UpɎVMr8;rQE9pGҌ M; bhAETR MUXTFSEPGj*bQIFQE(((QڗuQEM1zEXTdVrvdKp*H<#Rs@Z\}AGS[1qQErrz ZSғR\($*iY iR *Т3(HOʤ$7u&溩ArVAESqښqiwfӗt6AS 77LRstCcJ2>8QE($I((iǙ_ae} ~dtncutVZY܂>AܦV%hݹV|=F@=vSMӢ[(^Qr=ΪYT==WBޥ pb4 HJG NTgIEQWԀ?6HH%O9uE Œ߅Ou[[Ta#)k y丕YשF7JPOtSӑCixD-`SVNF߽g4<$,iQ֓לs\eQK>Rg\w (ҩt4߭9 K}M0L(έcr~nim$U珦xCo&#\O?/oZߕ6ovR xyԊf 'GO.`ё9-F1L)+18ݿ\YoҞcA Mǽ;-# x#<҉- 6T2OC&-\ԌHJ (jJ4sn-(IJ*L1¡OZUqPT!IPj$A^5hޤpUܐIJyjJ$; 1 h\; =7/p'4QE7hQ>S=X1H9QL-/1qg +Z3-(WFyw5zR1KXu΢)Vk"Qs[09;sJ^Yoتݭ+ @y $k[[@x}\I&d؀MOoi$8ڀdLyKZ9O܌947M+ʪE?.^´l,$y]v:=$\X+G[ϩ^Sг 7ʾ3e=I5yq541yH# 砪0iykym2;ӾbfCͷOk:W <%EdŘcԞxxx|v`G ^sVnn}=괷xA#/𪤒rNM:Y$+jjq"˜zjqKViQRop%sCY\?MEIF`lSV8vNq#5+ (]Ѿv=WwX?7pjTf}w.(R>5&|QEw B2{4D("f?JRh*cy(MF+QE.S!gT8H'ަnaET\/{ivJ9ۚ.B (vRMc9h B(.0κ #z~Vl~5[3l-RQTAf_Znzl#znZ (@$e!Q4ܜv#9$jQE894ݣoei1H5 (sx39K  7+ĴQElRUA.)A .BT0Hz/yۥ*UI7t0,hbFTmP>bo y)בc-dEgUXb _[h<2^6)91+:JN)iۚm+YBU/QLtnIK-칵 #]\)ӌ k'v;-M̱3YǞP ZIX$Jh5^k&#X#3>5RF+>2܀w8C n^A9>cvG91D-̧k ʸO5-Ж'+m8nޕ7qn<,p{~+I59n$,LuK{q?8?uDFHWoUS>Tcr+VYl#,t.8'1J}+ʔu:re nf2L5 R.ʪ2zZtcQ-҆n>7meB{zz2쾜5.֮[Zti9?ݧP$G(8sGȸ8zl$_ W&2q\70ۗ 'O5¶:n9h0$e>n35wOԖ ghCH ryY]5l`\i1#aOkʄӦa)n@%2ϵ4|v`bBIFɭ5_"O2[dOZ˸"'ObexLTUyTmcQKnR>d Z&S5;sFXn VԢ(SOګ'ʾ"IYީȧB%'nY")_::r(ۜOJV>L{5,) ;;9 _4[UL]x}J,Fƒ$IDHFEw֩^0UEt'r;~W'qS =}{-KWd_O5ѩ*o,TJXjЈe_f]wWAk/RAN֩/#BOq@Wl*Ö3pJ:v؏5j|*V9ZaFkң1)+uBYs" 1]V"a>Sٔ1ߑ ZfZFޠa"5jyvVOAF=Nەy׾Շ,I[FY"f*e;O~5xVIUGZ|Yʹ[~<}+3?m&n;fխIOlUVSJ(1l(n,3[)D.eK6>|Dvwo:|10ig0,g$~4U\`ZӃMґGbĢ)3VgA楈M7FS\Kȧ_n~ QֺBTylKY[J*WwA'Hd++/Ò4wW+iqH $r0{RGAґ&=8'R$1Ih9HBuF ֎xBBNh9^JU8GQ:.GJ`=ȭy/-Š)iq)O/(%֓M+u%DȐQEr+RQENZ:D(kPi~]P*)9G6 |桔~W":(Djx  8JY}O&ϭsa{ESO'AAԵmK (6QJw(QҊJ*Š(өWzQJNW"§"|eD9VR%¢vJC}jH%*]{+.@;hw#SR[敍J#!ۏtMKV̖)W#/jehU=IQE/Ґ/ziH)evc^7Z]'8*<4|!E>G`MuxRS3\9? qcӚBnw#uXM*0ē[eTCŜxc4w+:hZr;~ƹP]2۩a @wc4YmǦ0ԦYEjG `C'h?G'J(cvZdfh+aV'?E4gx|Rg/R'H_UXGJCoQE'G><푐ᔯSkљPLk֡k+7$=bl~qi$(0DG"WyDM#]EkR,pF8˖\u1* N??Qy >cRgHrbCN/OW]3[*3aytQ9ttW~V1/k {ӧXpOD?RG~'kx)|dE'ʥ?JT_ a'8*+:^AJq:U#xO6CXP7ⴛGu镨_Nyʟ,)Q]!\vܘZ F3E #ӺQ,O$])W3{1(.-嶙 :SQӹN^QE>B MUXNjszVw K(9=eZ(&f8fڏތL~())i*Ԗj)>=>U=j*Z )WzjHUeQO6yfEne%ĐԞ/NJ_{ `~ǃ?<˙hU,pBf MX2y5mٺmL,mmXbrOS]kOI-$c ޞҽLn8)&ckg]Cgn1ެY}+qYPye(rU[^:?yg=kub{[+xYH) 2byj8L^b2W;j{K SM%ޡgmc_vqtWzЙc©%Ē E,W%[xsʢqwj`aBS3y{[==sRv& * vNPs*I}ymciF\FvI.Ve~JPk({yB}Nd-YvexN?Rҍ;*,2ʹr__Ҥc +̌?PAv2L~ci[q_ R" 銖IgJlʌsUwnIw*L~EL5NnUڻF+P\mnn#kr$!kQE[VUpB 5B+ *1Sʙ=J'ʬ( U]s"}|'bẄɁ*m\̐tYcUj (UדF}NU75m=*_p)kΛ3Ix7m=Y*Ń7hɴZn >evQEu=!7"(W5 ,<(ĭOCL[˷8U?^+0tyBӌرfؒ2;թ-ƫq0jHw#U#䍛i!$aֵG#+)sW6G({ƻ)ail]\UIٶUO1w.a XJ{E1uߝsݤVB/$ߜ9VKeǵkxLVN =?J0KV^e;cU\+u r*bF8ASޟ'ZIӥ*)gTQNmjx~μw?jƍV`( *ޙnfq$|jޱ[;8yFXzw?ZhPB;#^XѱE.^ۖ8֤U\-I!'Zw^ix!+NZS'U]3UZ㨫q DVϮ+ִh{u.yQ+9eeg]fc272+R$at0pV=GcѢA*#'tZ鮢V<9yR |$ҏ?$dd~t;XP??Y8 yO7+ru&",nFU *u[nyj dF|ۜR+ ȿ&h&Ab;WzHn'sM7JK_mͺl(pzoIu5 R ?U/Eo )bUVU\m3ԮW,U.P9_)vDUUo̪s=_ҢwR2? *%_0v3_B0%>eHY[*ϻ<*pWq=wnsޅ8QBۚ0M8+)#qBB3!A+ N輰%|9-L=&܊7~e.X7H`'Nb1Yvc)fhf98?u\lKV?+~>1Xij̈́5v@WSbR t`aɱOzsj{9pw-U:?LSa u1F~QHP qWj[\6zc~۩Ց-ij|~EAZ}Є_'̟\6$k6!;/-ڿ#>ΰDh4g\S2Yr1To"ܣ~W1EWuQWsVyAXZbkim\oJrTwaoPRJrT(A (,uz5574P(0zsRaz&ӊogCԤv?*Ak`? 0#[hFp*~?jGj=ǩ)dGjsi{@P^3G^wQ4s)x)O=(@Lq@QQ֌Q_ʗLKdcw/'~W攓ǥ'JB]w&y=MeRy-JKw/mC*CޑNi/KQEȣT(/JAH(֜xRu0sUQE#/JF'"S6 JQHIh~ҔTXRQE#iqmK%QR-/jEUZ>u4(h8KQERRRQM~2'AI9ێ=)ng-Š(F~SM5>J*Q(wzbMF (Z6ir`)pqJFyUr:ѓ(JT8 Q˨(QN8}Z%!E_jL|JQ֚ZBQE-0QȽ}֥^5Z7*J(dynv0~H2jXpO܏Z49i)G (h\*ip>wh)]r }j3-}z&j;C;GcY[=}[4W&`[v:*t}4i}vD½U9{ K-1-Sn]sX!w Sgc,,jxa+ryc*$qUڢ-KX{+AlcngIߕG*56LOz*3 s^"8(KXCWM2d17?+UUQ?Ω>{[5r ~r]Y%ɉ_mZԪ+9褞jjNUmO,N[HzUı86{ƿ=5NMxƄ=wqčF ry{$[@LrH9sұ^I<Ķ;^[Yh9 y9zS'd Y1b8N_8< Wtt_-$Ӂ\8hfyLQL̴v{}$mB9 V*\2)RЩ53YiRiN[9 Ue63+;Uj,tqWuMt639jVn<ԭl%QIs8R✮zMk(6y4rjpc={QEOw*k v9y\ޔ, (67wӔJj](7gqB7a" u|^= hzX*ͳ^TNW*WQ7N8T5 )V$}ڣ7?9oC\ujIp7)Fî<1QzF]_wg&8.QE;q^vIW'M@\( ̱õGOH`qB (7P"\d+('Jnoן621{TvMt\‡#59ξ}m%7{y3oNM+hn<6*èIǵHWPU-EN꽜2#ldم֧lwn >ۨ/Q  NHlפ67y$ 3jm?h17/zs(2ݡ#9ڙ_+1E2HS#O"&T}pG^}?Sf䉢vӊW/Kʞ[\.漪lʥ<Ɠx!y^\I;FFvSVvTQ'W_ajvՏ-ͽĹ{WJA{W]WPI $Egl-!/%}oǵo9Ҏx9ʐ[>B$gNeϭ4gAh3AO` u_7#XT)SDڣ4I Cg&j.95#lF`yVY>eij7\a^RBmV~euUP+!M؛KOo+"r2D|~xr09 ~#'Of38|227AF׊WMQK*i٦ǎ"km(&<ӸHQEtSI^M (izFq!<֊ūQRE )"mM"”RRdfqOHVM+\QkzM+vd(t~bOU)i)i 'zV=Ģ(4N"0))A␂(?zszOS'QE)F)-:q ()O4`fW(Fi lbQBPh^旪ЁQH$Sm( QO)Z@>QOBZ{5 ʻNJhE#)l2))H4fqLںQEc 8h#o%a`)] 6S JU7R ƐRz؉0))1KEer,QE%PE QE'/niŠ(lgSIR()(4RQESIhQI)h EQۊ%EF;Prɨ@z7|QWmJKpU?wPH\cz{Ty=++ݙ9cOjJ(JZ֟*۽+Zj̸nQEj逜n?ibi V^kaZqF6x:M=aď:JԝIJBmѸ;2GjP:ԘnE*M9<2icG8J .rS N:7ZՕD/YONVkX#.+>XۈB}o֚8G\F\bI]z%?2EjuN66&0Y>v 4':v?ҵsJWsIN(4 /bM O~HAzRd~zU$:RR@Zst^W Rp}$ԙF; XER8Jϭ;ȣgLgZ;P={RQڐdri7 G}٣\evE-=Js|)gnVݏr@)\S[:R>W?z(ƿy"$xtYJ C<NI5_MspIHM-y!EQZES62ZgyRŰqֈ7T}B~M<3;ŽŠ_“Y$Qd`ĜR)|Sd# 4M!E9vg>)_3Z>Y.i>N6{Ө_GK'{+mu`Ȥt"*NXn*L}LۥUϗ}M\pz4b%:Ӕ}~uܧ>;PzӾ+ҊձSBhiQWU[g(mPP J"4r4mStyݎ|ЧE;RIc*wۑW*Һw6O. W9yXYT\R)3V]k32q ɬJ᣻dU_Tr?Uԝ3?U?0"OZzgVoZ (NzFjo柭@W)* p*rb]#W7xQEdܠ<3n#-'Ųy4O ;QS,4q誹dR6\P5QQVD`/SKprsTȥfss@ (-8ѺU#QE#@w\㴾lJ%"QE-/)?٣͔qfz4 (˓ںm1Sҹx)4$#+sJv'=c?R)^3mŠ(ĸܹA?(5zJXB[8biZ0WFkF ;:>hՖ,c}o?(57LXGd6>[59yWGBq kTcˑ+:x%$;wF #<&G+ūjB/]OKvϪSyݡt$I&Q{D T5wgMg8EEjHNX&Mf/j1*ܹfݳGAG]+k3l?SV3}VH顫VD2uTƊ9ۖ[oz8Z{ee+)Urvڣ9WSV"P1 ~tu vY٭CTZƭH҃69|@j̎$Tr.85OPm- c5y_z1Ki?_V7'NV8𪜤Kc׽Q\8ɳӡiIsnq\8’3$gThYIu4 yODcASUi8*hsUwU]*yuK}Ǽ v{}mŴku>TFIFUrc 7t9~S~muwL=1McV^7gÌUȈyE$Rd85}q֤n0Nvi5dae_Ã$ TYQ1B%zq}_ѫ/\_6*O?5NhBw!16Z,m 21SUuR]0qR%R- 9b>_E^iČlu {&'H JH9xߑS\F X#s'm2?:4$)esO`cd za8nB\y%qRw0۷68PzU:RJzQ*nX?vں\#VSlP74isMk63E%#ғIY6fQET GԸUq)i)iBҚALbQEJ^LAER 3-'" (~NS[Kp*D"Ӻ/Z1ZGcD ((4E1QN'(Qh( LKhaERJ)ɧL7 (sK1MMc;FƗyG!Ӧ9zeo5RԻXRRP)' TQE;YҨEM (:b4qS'(C8Z Jzx/duM5 (;ќiVd@QE4AɒQE'֒d(_N4N(C֓RyQEs֏$ERУjZUZBj!ERއ㠧 ̀ 4l8ҵt99Š*vްʳ[4X QE/Z/"DIb iQvGN<®i6PestU:#a[5ۯ'V^TJO#z1#>OSEmUQۊsciq8*r:'G;~񬘵>$23*N)">r\IMDATKF9i8ϭ6% Zq?4w RthPH)OKd}J\`j y97>朤m4fw1.@9d6eOJ3*bO4E3Sō£ٴRH⠾C%3s852RGܺv'5ŘS8˱ˌ+0hN+RTEz{/nOּ\6:czR|feQ(QEsցsAv&0ouOLp|9*k`vUxzbڍ5%rGޙ{5wv43"Mn*Ol㎵9hv7_F}2ko޲Z`#GJOZu6CYѭd#PRckҡH,bU~zL:hF5[܏*Z  k?mqVf`Lҵ +;]^5?N݈sN;i!m:O8jdIy{Z''STEV]ګ˧F2e\VT*dv_i'j1qpeWxʔ+۩Tge*HS `CWtsrEW?U͹E k|Tp:Dil>>2[|7vR,2: !? ^i)dǦj0UP}jޤʧ$vB{~FGU*]SE"=?JlcE(4?KAh \lƯ(wvX鹌|X?&I^ekffTbEG *2/Zr]˯iǎ2?A]r (^خo@TkeRzcWL8+r(Qr;u8  xP5Ua+Fu ILӉM^ 1:ujWQD"s JSF* qsk$-KDZ~v>h˨hWhڠn-.|ZVgSSe!(8cW5mQoM߯zNxt1}\RTׅZRtjŸyز//-!Pt:ASFPs+ő<׫*н:VMlhAqk{]bȈ@@\VR$H?4c |k 7ۃ:VAV{f=Fο9MǓVEbe ?;&^"Z|JJim볯&m; sޟU*؎|4xTOOhAۆ/OݾN~nYZE >U$5[Kp$-Zjbky6w"?GjB%Y>rKHR ǍsުL"G*UH]Ȥ~_j.pYk˹'%%<k*2)Gf)E%k܈ J,Վin)7AO.3I?f3QIm9wUtb4N1@_(Fo+sO W?O@QE3y6}֟ ?MooQEUw|)ۭR) (ܧ~Te?ӷA<QZ|Š(K?GB-·eTPpK峉V, -68o+8DR*%+!%Hm<˜t,[SM]1LPlaUv}}j4\G.+fßnVkws:h$ROKmmdF9,}?Z+ϚdM܊HIJ.2qv>u[sjU栦̘oT?:s[c{-KkB/ֳ5+i.TwL#O[BF\^i+SL赼hG{+7Y%S?|ުmh۳)9X{F',E<"= Ս9#6AvNfGmc\_ҵI?vىΘ].iyGoO@G4MQ 2 (ii3Y4@QETIIQ{(8h4QE!ANсN`)q֗zU6v (ӗPR 0+HQL1Lf}MI#TyUTnɊ](k0QMK퀀OVm8;zqu.mKQSGo+6ɨ^$(`V /&=}Oi䓵EPxi? ^Թ\AE2k'#p8ǩe ^ԫ ^Q/,Ov*(JG̭ږ5xчF7Ye5)"1nC;r2mż28׿X>,t4/18?J@'4_ (Ĺ}P7}jK` s^"8W#vh$qW9TT]QEhhA;=-qns8ҽ|yhW:NYqEr1!;v(>QڽlYNFWMn0ʱKN+]ܼ9T7ї5T$ӊ'(8KK!@*x YL+ʟ {} %N2)~E 򪚄,[j'6+R~N[V h*dm{W_b}RU=sΠ{ c2}NgF^BpT";_Շo+JE\W!pj[-#k+)?#X{+|~ur?RbwwlOD X^Z(GU Ɠ§OSzmb?QyiaT HQʓӽ_. R|C(NiqM#i@z6MLM)8jLA(KS/>޻Ee?)9#k蚗Vseѓ-8)5gNy{#֮z~1??ݮ zP ⾉i (u~6f^x*yGG Ք%H I^xsBe%y^B$9U;,*nI,[$zO'_1@E\ԧluM~𯆩J>f{;2glɦԷKEh 4eW^d~dT 좋?i3|O sU3ʡWW^u 1 s;klMvG>XT")x} [ckDç۵svֶH\"*ES"XHѨHT&Oz'r~at*%~Rႊ(O<4IN!n%R$ލ"3ШȽ (^P7q bIe>Ɯn"F坆: =(i5^Y6 ^k{'(Ttх4+:tQE.ڣ֌{bQEE2ίha5J+>\ѭ(h@)y?Vb['QT b_QE|(4"'(jjւsHy<( )v!Uh863 ([r$Qyy_JW #_*"02CJkK|J??$ye=JI{О)UQʩJLϗLQ٪K_4>IG=`7kr2 UG62 *2s6ZhR<ȝpyCҢ8mke9%&RQͧ\3[x6-CLHTG);TcL!!I4egoM FKM~ 9A[LX{J>x_L(F/hvqVU_.(&v3`I#^Y9\ ¬|G3[ΐҞ5D#H69.HQ v9#y''iV%YqJ=U7٠y{ھ$WY徵MaM8R4w97xSqw kf  EEBȹ2*RqM vpZڮ6M?o#.Sa?*d +dl~SOCLJ$pd/Uw΁ |e(qKD|7mK!k-252ߺsEDWi=OX^A>ʹ)DqD-j)g~UQNh?uȨa|3FlusZIwm`'$)/>[%D#Dڭ'+h V_jՋV&U?W==^_LiV9GO_&Ո63'1jKZlB;jꪻ)8W8kh9*rVD\N+܏#F( Ore&^2\aP8(Wj?^i2XG4n 9Y;'>*e:Ib!OԪڣڴbMV.AQ(N3ݽ麅In<$>ջK8**tSQx(bTm*y]D흝݁b,OҬrXNܮ^˺3T%W9 &~}Nd%cZ94UR7ST+72@"VT6BsCMJ= *WimR$ݺAK6Uh$f-Ţt5mU=^5RK2T U稪W:ry_ UߓքqzU'NnD[?IPgHۭ(ܙtٌm^ةɷ;~fVt 6 fTEwa$I[`wT94R.U"Ia}1~SBTB!}? N.ɻac+m5hP2/eZ.m,^Jn7}.h7Bˌ4O]7C#n+W n9T|> x5(9UݴwR[0ޡmvR}@똩lбnv]]OPW.݊{Wc`7R2eAOXAC*OwKdӥgDެ>8ֻ-3Wd5TַSZ[nzF+.T]Zq:M{j´9ZhT=(m8"\2,Wº!-9bjd}i#'_ x ޲WscVeȷ))vgMDvUfqIQkZz}%^yBS\r]^,r3M ED7,NXmʹdYpWIb"RzXmF3[Tu.&>BOEU] /Srx-zI8CYܭ58<GLMAE!"w))IbIGJW!FsО3Js4^gڊZJe)sDr:ҧLth▚. rw" D=O8ޖ1TT$c娘c=2jF'$U.Vy V# feq5D3xs1]!t?հoMq4H+Qڤ@?泓QEpM'JWI`Š(m8PŠ('Zu5zӪ8QJ)٦(@ӗv QKhiاTrQE(|;I$.\4^[=vУuѣV:%-""b ;W«Q[d(Pj ~*f?AwzC[^z+ I-OT=t6⣕) 'd԰ EK U;"NV% M[#Ј;VqR0IM, ,spO;;<9U SI8v/֘ii)T|n2JZ(`ДRSMnpjIQExRRҒkS'QE"rKIݥAER=iW=M;EPi>(^iGJ;RF=Zq)/F'QE(8׭H"tuڐ>hXQҊ(#^ /`W(bbIEIcR|ƔJ 8O44֨{.{SV *jD$Ni" 4ࡸ*)#JܩJQM 1J7cȪų֐idM+*jriٜʹE(9(P%d֤)åHi(\Q:RfRQJ)qM=x#QE=Z\L8}qWrQED]ZC ֞ ~4>EP1;´m!ۂAsһbۨpԏũkdu [6w,Ȩ==A*Ar+MʷS\\ӣwM]9:N:&o%g uHښyLcۥpS(gb؁K6w,K8tf8T}sZQ #?5ee9Ģ_ʔt@6vh(I^y4Q@^ž:S)~^Ɩ.h9i X9z~eTSBysLs&k_uuCЮ*aeqDcegs+!ihӎS/6sA] #煮YFph5b/&ӱUҾv9$_),X Uvڼ-~N^)=k +"ܵӐqN=c?.j3j&mQZ =jg6vn-SY՟r䢗|49:RB4&mA>Hc?ZaG)~R,&zz$ xT_h [N9?N֬QъLg""zQFn=dmzTAT**OT_8gn@Tw:TSD'(STW֗JKkH|s^DstF͙J+C;$ mwTdW;]%^1کF#9=9R;"[nVU6ѪXQ fX/Nn?^."mtZ~#9cR?CSjǥIzۮ3L~H+) Y[<:}jm}h-73qD*via8'oGE_i݅i6W\# QdԾq\ǭmc0ҥR:apRH'#)*7}URāvS*k͊O +KXR<-*򬇷޵ v9Yvq]9G_تV:kBzscVCDqSa55xFK(P~VjYS]q oBZH,2k yʲkcc5?f|~-[?S>oP W7yvU&IRᡁw8V =J6I*3/*V$3ש/z#s[t2HܞՆbA.MChVS+Ws)*ǚm5cn߉ DLOUWx/֜sg>?_u(hHm#5L:͐ɥY'<,p7RWAfCiIGjmmsՅsVRO5qݯ5ν9*z7C*Q,!mTUqueck*اu$ Z94IC8c](!vg'=E *EVp9f*֪8QE?+ j?0ig zb*XB(gp߼3Zf,zQ B(!˚VlT֙TP!=vkREV_dZ1(v%(F >rB(4@(Tjq$?zƋQQS83W5N*j|l (IKM> (@8J9?HAERvsG>K0U\pQEtz$nӑՉ@3F3}iF?ob.MB[zY4 w[seu\pFEsۀ}*3L`/Z/6F5<*;XY'ӵs$oؔcl І}cE*C$NqکI%dy@0Yn6@hIKtUoMʸ2JU\pQeJmXٻV=uVR֤4m;@=o-17)q4V=*=tڤR&9'{S)V8?;;xLE=v4ydM(zqY݋TQE+iR>_z ʌ$*晑+:J!OL6'|==*ΤcM7y-LܞL5P./GsSËYnv#6? ^LȼαzۑU8- ,=Eb&D_ V-I.H©SYnI2N8"x"}#ߟPhY)NF޵WvI99*Ъ ~b+79?zH"omכB7QsIy!7d瞾ԟګ 8]eVmqRZLۖzxY+8-LT?%H~?&+V?I m=,=)9DeV+vRJ mۙy|L ,- 1*TQ>{5.L6+EVE<j7?hrB/$ҙ|%Qٶo>[:[VIXJPcݹިӼR+.cc~XwI.sªˆ@m*.*;vT( *af)M#ܢ$ ՈXOnUk=$9ok^bMO6XǗdIS' {],nVCV,@f;blNdmǩ^zmrTJ*yMfrbL$6Qӊkc)2;&RS,MA$O1~:鷲n!yUy;\t8E=%}qޚ~*Ⱦ;g$rլ $,{JlI RPWMb>unC7ܕ9sAlz:|q-\pNzpZEH^jA*­FJ03P}ŤBgamOShR%ثg+S!eIaY1~$hnN~hRi?byE[kAg&៾ Ry䃌Y⠦a^,N¥s'{u*{m W{P{vzR %ڜGN*Ce-zU*SKsާx~T<ǽG)R%:rC_SjwCmS9(@#<d9hTke1?tvB p¬bxfnx:~E͹Q=OJՋ"+LV쥷iM!P[~GJ>њJ9[w̞ԾC]G8aJ8I֗3"LaUuj##R?H$돭{@'`C֞™2Μj1\r)(im>#yQ8ϭ9x?^N(旵3IG!<ޘjell;U5KrM`eu,1+9Y}k#F_#+rh+WWHRҼQȿ,ck}($gT4݈)ˁA'׎p袊 <7SIޛZQA 5qJzPRqRК (O4jOB(UQE.iMN@QJ-Z((LԬ*ECާ#o]xGi4ά+5͔1XJd&3*ӊ3Lw6Q=L y^i4ΦT_QDnsN^,|Z9֦SFW 窵8M \>Gp*usQ oz~+KIKI(QE)h"D*)>#i"ȦVRZŠ(u6>V*q(Z:P(QEQE; E%-5'M9ЊJjbQE.)5*f)iAJZJQIMY\Ә~i')(J 'j3T1hUjEKPh)X|IK*P!ivv5Qc P>\iAҘO>HSM4I<Zy␟ޱSFM&QEGKAR,QE5HE)#8O)!ER\1EW)AEQED,QEJ1OUJ#QEDI .i}Cgi_¬]cM1?|T%(G*p3Oe֔оQơQECK\zzU} vɑFwaŠ(+ɡFV f,ICqW(J[~2ORIl95H2{Vtν<'߇,bIpW卋 }?G W5ZWQF,Cdbm| Mm(S$jU@fz g$7s+]>[s+?AV,i$H1Tl-^V34,1L hg11NqIEP!}:Q:R? (&9җ4ERP.ΎQI֕p0I46c=OjuizT":Tzjd.:U4 O&$DcI7lF\1'ʕf刲d.y?g^s3VDn/JR675ﻯZW[K(G]}78۵d++^*T^Rt60|cnR Oi_2N$`6'}f\ AԊ̯Ƅy#Zԕyc_= Y1 Vڟw?JIY>Xnr @Ň==i׻*ORYa6eɆxYvqAokL(Rs0 i٢?JzO3u5+tͩrɕ2[QGV(0U Y*5y\- \ 1N2xr <[-k یM3W/-P“%^m%^M]cWwgZ;C Uy۬Tf^+K{wP5?)V7n~e%Cxv5n2䨗c9ҔJHUU x`U/5N=8'ܢ)kC)<{9 V)]q+MˊW#>{?/9JjS;SuNN0}?zRsחR6O$<MLr!=kzth鋯͘fB=:X9W/"V &[?zXL.aJ]k&YWfs{ny+ DSa`LzSp}EŸ)Efy$OSK!d*cWMz*?›Vpv犰,PL2tيaN!o?Š++k3zA\Wc#j&Iοȹ*@sU]yĠ:ls !UڻXךnLqE1Ģ$v?dV#UsB;ҝ-%t"(F_̋U_ΤP²Bv5iL^@9l )ucGQr? Et,_2ż1O4.F=x²n ӜkJb| OƵv班nKɔBw2a*sTy_QUV]3~ꪩ>Dr#owʑƯ S³bIv8";so֌ׄq ){ѵy+hM6e |eO8]Dd`ʱ4t|[lO4NҸ6/\v6pVT;M|"*}QUe=sN1=QE|ޙ3Y[(8aZGD:baXy(rڃO\FX 3殢dʛ8+"3]z)$ZG 3*L7Rw!]mxj2OjE-K#pO5yb .d:Zc3݅_J{zՙFٻ:Ӑf/ӣlr~5?"66XzYG_XN $cz5ΝQZ]`V3}5 5 eO +=*4šO rR%ӜYZ9;WAI4FL ?qUu{_&(y#֢qQ*Rڗ2d_ T9R*J47y{Tk6a VcGqOzWt!P0B\LjU)O+s5ZIsS]ed5=lwKbVV{Uv855؄'ojd9ɤO(\QJp`q!}~Q"jg< :)l=9]G1Ut/Qp{juSǖ67|$Gf1J]E jiq={ =r8ƓZpv(@=)5"1)v);RsKarD Rq;)J!S|ݩ)ۏQIZ^QVHdf'Jh'?֌POHm.W#܌@/\bD-9lgcGZ\bTeON%qjZUڞOW-}L`{fPyR+EKQ+{Uo};W>1^NJWWbƊWrO|q\ \G:})ɻQaR!b0tW=k65"|ˉ4By4QHQGz(=iJ(2qҙY jQEIݥM4WER;QFqLaEQF(@LaKES8rp)-hĥ^R!*AL0xm%;4=rґXF5wdXIԔT=EEȪqbQRI֣. $iv68 RZV^|T&ܑ1Ccx4ӎ{L,[zqCqcHhUf®j_f}*ה<~Q}%elRT :C*r~UFCѳq64Tgp}i<,mjE~l z8joE\g'浧szSO*ݥryv+]&ᘢ %zJ~&En5z Pɴv4) :aF1m-fEoJҺ]7/vu'SآpđG\ q qHx(ZNdj@ PNҝ:S1>(E&!vqB4`((Z(N7(sM=)Oʓ. IFy"X0sIj\{ҕqQKP&ӷ9m<֦Q)b;G9.:1KIޕzi<6 8Fs׵F:NSgIopuR| L~K:ip)*r+ 2Pxf+*n5RlLKvv'{tkkVy[kTN.1s>s1p~uy;\3&VMzi5ĆnWqJW6:#gpB3@FUfU‚@ҳE˜6>է2Lcpyq/)JҞ fSY^z?UBYqERp2ܥs{֣`^8sc$zz˂dxiԶҽJ*z4:jFʊ\yQ7%L6썌|ǿU1֬_?Ɇ5&Ӥxo2ĊX9jU#&ۘ#Um[==jb2q;.IAƱ*\zg[F4} ǫ|= 8^y1]DHQ*tf/$.ՈY˾-$*"c S0H?8:Smni ٷUhWMBI< PDEj7vuVuqdP~>oE Fc쁅ΪiLIdN0BU;I\QG.e8Bbws@̫9 שRPr3H^pN9[^="W~0 jexLh܂[YCNWkK{U@Q؊ sQ6*sSV\O_EYŦZbٖ8dݢEIM,p.UEǽ:$B% H@,3T.8cHieI'$oRH4$`u1f$y'%S׆ZUzWs՗w VF#8Rm4܌#4FFi)c"+1I$!Ě:\3Sy^jaӖ$cf !99ؑѤ;kR~QMiJJ^@X(hSR4玴((i1N~QE!Z@)^ESH{ӺuQO:BcMF( GP`~X/<ֵ2 (JG*/yds(IF֬|df8QU &%T{m*yL?㸔Td(zfDSOcmA<ѼSoPj繴N(m9?*#<~5aH'(QP-5m0rVh D(4I [OHiѝ4{(E%2={ӕd{YA?dQ[ndAzy0-`UJ$cG$O庰u:RY1:"Nj{ ŵs'aǥyx<\{2q([qLT(`aSʙӚ axdf/\[0KK,4l>S\X69FnfU_&fVy,j fso1DɲDaUHdzǼnaM!AP\\QM i1ץIji (G34BdR((*p)v4E(O-֝* z7.תzV"krG- 6@LkrvW3Z:MCOWrHG8v5,Dn]Fg^oEƢukF#s tƲ6v\OZIhc# gTRr Z>/"-B~#m>:Ar)ַg'W(2Kl(Zi`x|A^4}3=Xs6udBjlԉ1AxVڎ.쟥[յ dHW8E["?*VOh/m܄˞UE*q 5Ppm{.e"Y#Ĝ&[LVTYknc\r?JԈ:;̄r*]dE=4ߓۚzǎߑ M &,)L2=i,ڑ*JE.iːsӂ0S Z'-2:FL|:nWTdIV2HÒUMY,l؁.Ʋ!oP~$UUCԮqVd=sL w*3wePTuC1p}#K}2ǎCn?Z2~rW*Ud Me)"S*@8'4Ƅ7c8g:.M\|r4vm1SֱK̑Hp^-3eyKMƓǽRVҝ3mR\ϥ:5!}]rD϶EM"cd7#E!刪XLfH*洡D y( 423ֲ[ⵜ)'Xwsr5Ց\& !\TuXM ] [*jw NzU/1x5b}+R8xV JQ+2[NG^K ^+K^2^~^azn"WᕇbJ}F9{֢{x%8$k U@ϖ7T;mu5a,z~ق8iV>[ m˜V4d;x#ҳEox|vvL2ӰF+zܭ-+sM`B],PUO$M#>CW,$YmUVj 'v⥷HіsyK$Dl\Gs0>T5z߽K3,OOZn0i6agኌɩ_c/+}X\U俵I0SN_p*ݪȄWToJ?y[(Ee/9c oi>Omj}JW8#(Z**G'4s2XCt#[JF?#ڷa}0إ[NAs%IOOk)XGGԡԠ5EOJ~)1Q^OkI&۝:^#lzϱ}X1M>-܋ig%ÂDk:fO4eN3'Z&L/#MgξcEb-zuZ30KHr]*~})'QM*9AVjl֥5i."Q2KX0\)qN2}gskB4z3\rլf1ʿI*v*f fM6G+gs<_O][{ +VovXFZ"ExJVxWg~8c1;UmǸxZ`R?jXpk%QLqh#xw4QEjZ]n.P)a4sHrissM{ZQFiUI){Ӗ"QE-!yڗRgaj9yGnQ)iqIҕSʙ~e#QV Ypj\u GSϔN uOQbOo, MFScU1֢GdѓDtRHi)QK9W#$qJ%QG֘Wlc5ۀ~_JY=HJ1iO8:>q!$rֈ8ERZJ*QE(h"QE4~ZQXTQF7 ]2*8C1LA2G%rc9$ԇ@Ԟ%mIFTWo:(ﴑs! 0PSybA(}Gz瓌$Vb4q? Т)v9HjU89iR2 ^9ݘU{i ^]_\U /hWćvڗR*/m!j2i5A&Fiأ6QE. ? jyIQJ1ޒRwiC ()yQESfS(QKNE=E;qJE4G5q@zX1a$]Zn*7X|4/pGBKk mRb#?!T׃N%~5~/Tjy&?5- gvVMMOom &PY8bpkNB kl?,te-eCd߇Ii!0Tq\AqxyśS@Qg>Q W{#^4DK)HO*Z'~_ Oï5dǾߣ(¢QՇb`/7SۅgQ~;Oƺ$)̈gڤֱ$TB{?)>_QEđJ0*)V:sK<^yIQ}Bvlezdu,_*{܊$DC6>b?ںHtK4u"w5?gBO'wzh9F:pXulȫnH0qp=˽/[ܯ'sfAǕ<U)XDžء7YoC>>o$-Ңc~U@P;W.ʑ*rH$,~* V'9AXQR4P@5V)j>_>Y׃qrnZm픵paIzVd%9GCaQo}E[O΃?tSz[MB[VL1FrfڱY~7qX։#{yԕr)._;^c{~G w2u82p +:lD?Z_e$md ӯ9vܿCUl#~U~4unȥs܆(C6cE$+E^ES !Lq_gST0o#C ]:4`]?V }* 6-rrX/SH/#bF1ӕp?ZpTmV[Yת>W*Iu2K6Qj)$O$IM18ޔtL(dzSGލ黠( '`XҶv7YPlKs+Wץ}V} \E(BzS ⢳vH0i7\㱮 ԫo"5(cXNIDZ<-b+~EV4ߛPSl؞W5e/R~e&Im?}i42>"xUO4'ZNv=dIa*[f(&v') r|S|Sosϛ"+J<-aɚ8S5W5CpU:?@?A}ޔ_ {jQ ({HI|N[qSZsGQEaNLT?nTp}[$.zFETQF3#?IӺ(@y=j#yq|؆3h({7 Ugݪ:Vyf<(g}̪],(ELu_/LhcwEV٦gO1V{LQ^Oּq视g J1V.=SZ_ g| <򡣐ߕ[޻p'iƎL??/w(3v3ћE|UL}|VrJ+Pk9Uƥ׹>m{lH$SQLdV>š^tZH]3>&ʎE&ѷ K*A1k#vjHrLƇ[F~3FBYa,l}+HjQ, Sʲƌ5Wjc=੬uMUmpJFkx5KVӍcq]]ݽ6 Kzo2<ƼlV[GuoSCPV2W'Vx|Y2S?^(0@NQOk͹QWWt>3GIA՗9vC>r+Dh'*MX+&RCwc'I?2Ibx$x9Czջn!~u\Q7BPSm\r :Tsv'@-ޓ-` (czS2v;z|QE*[h뷵+䨣.>VbU$YdxFOQn)q"rv45j籑T,xMXf{3NƠ-1ݗeeSYֻc>j^Gl]3S2*Pn &piVp -ݓj т$Wp'\f08;8؏6UGFS guɇ;Dʜ%JW2愳q2m?5kkdm3U$2Jmlq$^T֮=*$D/OqV"`Df%N:)¹瞼Ӵ,F]'"uQKqZ,v*+in7YP`!㝧<Յ`t#-]N65iiVqw_)I=NMG`u5r$;Z{ceϠ/)T9&]lVa[[ͺ>T~=+XOzH_i\U.CZ9%e=B7 S&zqvv"}{IHZ.|yzTQÙ4S o2pѸoZn8MI&ݨdy$޻GFc&zՈFۺo69Ȫ3)C}B>\➥iOz1\4MU$jq.剶hfBd!1}p pGdN1J͌ͱb^ SRi k/1T՚G.i8rU{ج29;ؙT6ƒmlVv9ڈ"9<⼺]WjTm"-J}ˑ2k㻛;}jwܼTz hdәy\֟(!׽;nߎz26)6Ò}I&{VIΤ4YP~>W_Zm'x ej+IpOOTmVEeĖᳱOt2&z޳lĊxtyї==VUiRYMg:ejoZe*pj4Z[hnS !}}kg?jߊha. CZHpxkg'igct^r (llk9t(rFc*K_=~*) 1M.NkЌNYb_AR*9Pig◝4 HĞ;Sz!NJ108HVٹwuUn$؜ }k>8z}[95YJ:\z|[.FPs`-mzi+ߌq[g9>5:VaQjTuZ.))zSWڛuܨKIKrI^h(sZVDU׃M@cANP✍=)T3L—_em.hC✄YR,q#bUO::j*c 5dL a];|dԮ@iezT9+yaLFqQH99;_54li$T$er `Z\$hj}?:IiN{P&&Ja%-:iae%wYW5"DO8's]R`#Yh6*(C~Nj6r1˰Z Qs;M`;Wd(SS)<7}uhżgpqZ4YXvtxgk\yu;q:+F͘ iv՛N9eЖa>~ tΏp-qHֳ*8_3C >g5 D%6s+?˪( { _ һoqJ?Ѕpps]4Q*{S>Tm6r)_LSvhǺ*>ӜmgI6FSx=zՙcYh2N:Y.,! PךS2)#.E$p)qNTsMNjdSVE J TȜSޘUmG2+-u( BI XVUinE@i 8))dCE-Q)ii)M&XJ(R㊊YD|,}'(]MEjQE?-D1|{"JH^"-(S8q[#H-%-n=1\yS+3FisKzFL~4vq҆mV~z$֖5"&I3W㵎}uaNRѤ){(?mk",p5q[ž6v& \ 8U,h<Z{?#bul2c 5*3=}uЯ*xįʍNLW%־߉β2®z+w<+ui&9hX?r0X2\JϱNX#]e'_QB6G#֖3gp|{Pro^6VCЭsJ)h@8sy>4’(#J:J@00M'?!CCW;=5Oy4ISV?:m?=AJF7'sCpXG3=jKu>\hz}ڰ\t8oš WW`N, P"a}wf'T=\my6sԺ VFĂG-ҥ}*D?tLF.IDP|mxi(sSZ2*8GYTp롿mF0/Tu6@r''r78+絙VKҨ~X/ޚҍqҜPy|{;'F( sz4x+CQE .zR튻X5q5ƪ9N\ZQE>8˟EMt:ȁg$MX$U}FtE!wH*-rJd9={w)ƍ=d س+E8T2]FE;Z^Y-ъcv*ԕ*Y*hkTW#\z5v~]R7]"r\tnIS?HIvn\s&'_99Imɶa\N؟ڢE P9&ERZ@vz\SIŠ(nBjUnƐ@_P(l󧓹0֚'WցQH7E8 )bGQ@ (R$esQ'ȧq$'=j8 (}r愼*;R-4QEp?~b1o =z]~Ƈ )r(}OO<*-/mGcCQa(⊣Yx15:ws|"N߻W N';4;E/†?z4?AikЌm R gJ.إuݑU7d,\nqQ{*$pyLm8FFU79B~E*= 6*JT Rh 衿hp{Z"~B: ?JFq9%A7h()*?C7͕>jݫyz0k#>G(rU?ʭ_[)W}9>8xmʺ|y޾,kvv#{0I&]z^ aq{RU)[vuoU%~˵:C{S^dRyOHrO'>yi jWk}3U<W}]zSh}_\*+/*c WgH/dg^56mśWn<s,O:sI&ӟ)w[Z}4*؊b#(?/LrrP} \\Fz+GMh)Ges j b(*G*v ulՆ)Z4lzC wJ'M}U`2*HAVh/5ҫZ:t5Rs#@=Z,c^A ֋>hlU9䲲y?HOZs2 H4%R%ݫ\Ī.ӞMa:pn. [;[䊎=2[Ov=Tto-ghEAKeCWry8'7%>Qj/-M+Xi7ö3/(}7E*?.4;IgM yEirw+An=v.i1;!8v8#+Koq_R>STp*ɜ#}Yx g?^O?Jꢂ(W8S,WPFN겨ZuA֦`,{ >fLTau \NZ.Ͷ>dR8E͖.Jm27 =\VXK;>AYTNon=_{_12ߺHE H[.GVHBvx =IRvQۻ_L?J(T\u.TAQM=PކA=\l-c9$hѸ]ޖ;>R/.WD0y]}E(g(P0ק֎zJ9U"iKkv8ͽ ki< 'o֧_.EV-XȏÂ|{zV"Wn1EM.JrN[ =\'wKwcon|OX4ldcﰧM+12*tz VI uV۷7]UesܲVu](Tn2n^F(%$dg =MdYT?7zGsU! nS`9❐CrHFyC\ܪ7C(!Y-dFҤO1 crLlsQFލQK OPx?tJ<ySMJBȜGr[6`UZ.M6hVO*E^F[]*8ܣU yє5?xdT޳. (|PpGҼڴ9FpԃeOKiX\ʑN%XaׯCZp] ¨G^>Ḝw`(BOcoڷD"M}?ν.7ǖNd=J]mU&A(*ꎥ~C9W#"e9R;V:E9\u>enNs0i9ǥ.ywQhL,"d3,`X ;TGWR?i>)1s֗ޮ;oV΅[g02OEe"1c˱53q޶:~9*& /'~VжJ@#?ng=N+; H݃8d%AޥԓQ/6{[uGRZJtjYjF+jK i|~+Lix'5!M9`fhU>~l#mґa2u?` ]FgNUp;ָ]Zk{Wi;ڹY{*QQ̳9{*IF7+YF *YoL̹UHm|!gPGϥzj#>Z]<2z70]iܤVW aZHn'&Myϵ!S<ZV:✤czJp1iwL'Z[FdO2(ڼq}Ue9l\ӻC3vk2:Q!vkiI-fUq90}jΔ&I.];WF$Lc=({u<:R嵄גG~xP>^HYĜ%*m,vO<ʼnt ruvT*"nH6*&ZtiBǝIQj^ٵITt5bLSqGZN))5TG-ÕE(9櫹ڞVBj{ScU^;VXQ:` !\'Wp 䅡L{՘.Gi ԞyFJfyn-ȅ|yo>=oCXb֝8'[5)U99f9$Vv劲ʅzXxfS4n}VDnB5sFQ Ďé<}k:IST{|^(fS'δmu;!LcFRjHgo.5mGS}hE O U u'sE5`yȦZ&iVE<{}}*g4MǕ?R 30j)'Biys` Ԃ%jHS jƬG](QT[+\qU1PCp;S8&cSTq'͢M2ڳS0Fo6jg!o)v&W)2mķ,P>Nt*$hEmNsڕFJ}qFjn p)FyN/؋ڊ(4uMD4WR4 uRQɜV*JnTY}}*\ɸaҹ*/]zqEoC3Uja 5(LѲNskSSâcz ma!@HjzсQ*])4Λj$#ɅsuqA!`]%?(dȥ 6cOigN^J+[ :b 0IO&ݍ2* IU@" iʩ2sҕ#$ԊE/(})mdg' {RȸN;q֕v9Me;R#nܼw8&69B#POl+ cՖ])^r)>SM@FM:KuuV E@l-D~cɟJPw)=sknnw1@7 *q M>b$j[ 92lwjc^ R/2K\/ v_R^/n{tEJ5MB3ҦT sIٙ'#lJn95DeNkÔj3ٿ49FKF7Tv#E64ssnw;TU4 }(ݣutb\ uye[ʲt޸5YIV*x4T+=6l*xTJe_aƪT% Gh*r*)2|<]g7OO(j/-Y-dY(nQr{ Rѳ{Ԣ5 @w\~*"¶91+c>8b2v_b1,ēy&pd1#Q04ޝnSv޼Qê (ړwIf"*&xb ( glsIߩ;[t¨ꦑc+]7.g(+I{uOK`݇FoOSV*TZ8ʨA9=>DmQTL L?r\HTRMYO Hp y+IjU{Ǘjh r1#8M0`[Dd|3FS[۩?T*iShI,`+3"%2i:h(@;gh1ob(c.~B=錛"p-V4~DPSvk 9ޫ 'ޤwOYME ?*7~5#fYHhl"#ޫJBi\^Bn>}QJTp}Q5Ƌ{>^Ovq-+̍NW)5%41\iPvrp#$m " pKwУ:~_ݽM&JٹgMxK4Fws"n#>[V_1rI4 NyS)V9U s֕l.so+[NS*U+no[>ZAGpb~*nǏR2lEHq gn\zl'5VhRޏt H[x‡~XkڟōB(ɫ *IBMGU}>@QlP8NteHS7t$2+pGQ]e7i䑠o*}*!Y#m'q޷o]K=~TCKԝѽkp1n>bH鷐ЯPGY{ŕN6d\ၣH<"'Ҡfƾֻ)I(˹Oc\J$/nXbp2sTLd4LqLc2OV슒FUl ˫F F=1V1jA)Wtce$j qH%/=8:'^.*+UT~tǷ4,UE65V`+!YqocX7:m 2CR\So3ۨ#ڵXބ,Xu_c].z~EӸJ%&MT?cpGU4L|Ў{,;wk-9"\guX1}1/\,ڑDђ("@T剢m>֝i+ok?sS^i/".Q+ZRbh 8=2[Qh5 (.1E`(\SH)J# (=(w~Bn^H< R\B'켡@x}M=H^kJG6-߾g+HU?EDs_z$&@u"8sSE.Rd?'Z"R&CбEHV/u68e|Mzr8e%ī )+r ?rKx FZ{c ղihejm*8wLꤘ!U~A[F-BΧS'D,|]?ENj[8 4k;ce<`8a P˃^HŚ+sNUsaӭxY"SL? NDs®AV4)?)U6`kڅ\vXl5_QSYn3Y8j՝"<{Uf KS@BySz5iFQx{~4.$m{TXjjFUltϭ(xSyЫ`GaعB'ֽUoV8Z/=cѵ-mn>Tl5j$7G7?̩/s>Ҹ7Ҵה= 4S)ki:㪟/y][rҜTzZF]ӢuSc=}Kkv!;ʄ;)$xʨ54-l,6[-6^"q>P{'=#nM%gO{YWkBy]}yR!}k3GU#Zn62|Hz[ܓ@R%hRccgӋN[3>ks4zm)Sj䇞8泵ű֍f۵%#"9k7,GԮ?QZ[s&UCHdPΉZA֮ȍ$h?$5_znyezַmՒ9cF%k&:2.r Q>D7I‘h~_ʣ0FϸTͶRtW:F+Hպ#FB!Tmʯһ'ȪO^T֯j,]/zg10oåqcu+-lVdƾj] W ?uҹ[IW?|3SA=:01pi8SB>~_i5F*H T5t~POfD&AR5!bˎ5RGb=.I^BYI ou(TdUx\U[zfwU !Q119 qMUarPHˏUڱilROE䚫rX3yo1bD;*j};>Y#5pYrq?δv)>x&vue j\Nw- Cқ }{ lln8ɤ S>Hrx9$/5$wi *ߔz ׊qGoj\Ss*=ON 'H g.*q8&zzRc^ԄyӸ?4z`ϭgvvҌ F1HP/˞jQRp(4pKvqf ˅4)nS :Й'nhER2}i=I !󞔠|Qv=( 89$椸ıiI?*&HēXq4C9J2Rcsۚ^Uj֫=Z 4ǫ}QԚnлOJϑ)syOcc^sky %gx4[缾6{8tȼK&;[+4Fb~\Tr5M/+)m8zd=+vJIcYHI Kړ4Uw *;}9fSm̿ ҀYyf*}Z6[z+ ?%Z*Ҍe%MS#O}Rn1 N+MiYÊ[==zR`PIn*dzj۠4jVUqH}=){:ktZ~A~g(:pN' R@T`_i-jE᫦~52 Q4x8=i NJ+XDs {sđ2}V< רezUnt< 6Y M8Sʘ“fhʜV?UL^h_,SeNwOBGu>檷#U&)sȽ+ce5@r{WK-za[<,TƼnP7Fpbp҃8hI+ O59N4/UUiJ5dX,{ *pm9c(6Ӫn10^(8!<7}#9Tw0?:#4?w>潬 T=<% T`b8vp=QFfuQףhVjb8mFzȠH 5ӣ ~N)MzC:7KЋhՉ5pP6Rg֔H)LЫkCKi Ͻ;9s^Cg2yc3$jQ6nɛQsP:{RTK,-L66ݏi~A>+CvultQ4m4ߧ'4򩑕=3}+^^ʞǁ:N9{M{w%"sڟj7&Yp:(2@ϗiqY7yN?LZ4{ɵ~]r4UM*49,ޡNvRaqNH)4EXK3: u F zS+q}>S8Oġ1Տlg" /U K,Z)GF+6T_> ?F0{z&0?=Sh Lv) #uǕE3<: whRYegc UW-s]V'8?wke,EPOoo ICo@1J?T V9;VY¸{$~U"j*-G>d#լ%nq\j05ͼrJT*WQi֚fc%ۦkZm[OCFd*]eCl7^eʺtw9"O+8QZIHboׯ.eSڸ>Wc>;]Xy=qVŞcwnr]%8Uz_33] b9V*Iwۻ{r{\E6dﶽXs:iԏc'm8\Vm֧=eWC8vp V@FOW"dUW"M__B*Kk T}*)Z#l|F+ _& HwztȪC~!ghr̹ۓ}eFCF^Eec3XRrq`ԉr'2aJ0Tx$p}(FOuOb;SѫbeѳgCj LO?· >I#|uU9)vuG*y?Z%V>HdV%qh'8_14+,c([m`^6#ή:ݛ57fzevܩ L$~UZQRlRaYE;v^nFFǒbȧfw̞G 7 Uda[L]1XW ˞Zsi6 DȐIU'˰'EDOH Q3J9DFsJ*[C? jR#CmJRPj?P)ppzHʤ&uȷRʪJ#VOVmwl۳ښNUG=:lr{ _LncY %iT_ϭUU$~mi!+ǹB^zg."6ˮY;5Og)}MUJ|]9 eXf;树JqS+) t7Ʃ*IE#$v S)N=jRQ^pךw5NȻF?Vg#փҔ4dQE+gtPҬq!w=JvD(Tڣ&!, ֺ=/MLC%S9,|ޞ›Ic ;kᡆIdz-OHku=M+!]uI`z#WkcNػ$晟Zq8b*s"/q?ZUj $_.O_zf%IvV妗\|'4}W̸JP}OaO3|L$+GZ}mżiF^Z+k&bB/aT.O+XX:1剤wtq+#wv?Ңk\\=)+O=[̑XHT:(͏ֻDGw)j YI',KDO+xDlhV<%tS޴&0z`VgQYLhJF8z>XE"f>af\F>{W59PīXU/sڳKmu1ED$p2ȟ]$fҨyw7ovD䃂 t2;7欬= gnkS54ҷX{~Bp)7,ƣ+}pZ+1RcA3^?s V0~њ}c=Z.!O"sUhO"*aULZjk5ص"Υ$$bU>2ArW*sUN3MuR;bXFkM9,T۽3ۑYb|s(s # ftnHQzRl(7/:[ȼdە~]F<| cϥe,WQ*ypP*r[S>M6y48QylWH0LFzW&;c^[0˦Λn^?maEOs:dAէ+9j*Zwg秠֯EE+^#Xrm?H&Y 0GSG [/^:hl ۘZJ^)ϩh)׈#*ǩ&t۹%̮GE>B$riY |H槒ƕBNBf~u>qV/.Z1k^5Ҹq]nF$+zV~Ev$"*t_ub;` ֲkpȢH#Unm~:$dI }*-|\sw/MG ZQqvE!SQMJڮ~YuZ][j oV]qLKF*~elcVPR2=X9W]&رHG_*9!hHx*:ڥ$b7Pmv3>XIIwSH&[%穈MoMgVo\%Ge]rHln4F#꽍M-~h͹|y5zѻޮz\M${֨?ڔJ\V`V9OQR&yJ*. (-]: @M9XLŠ(䞴)7sRU`}j)w (t")&N T>[!iEq:7H5glG=)H]UTdQWܟjF3J$m\L0CVuʳ%/t&8U*1֫lv,c>ΰ IĒ.6{wPХYKf:u Һ_ ƲiFu.? 秖LEqV5y,m1NrMuq.a2vkO#U'jr7oG^TB%wdrҟ5(:d?q[ZN.'3LeبOP*7vs9 1msA.V8ОMWH@]B;[X8 9?tם`)/~=yuhU!IsҀ6TGzе 05E9C]CRR|YIc*}F|L):OMYҗ+CcVHA!Oc\Q|_#/bSnHT搩S0iC.e̖9Sz޷.!;54JGM: J @?#vaʄ%𳦍IR|'oӮVh!һ7QPY!?'t>笄g^Ҭi)4<ysVlW&Iʟҳ5;NٯbiT=tg4{p>L~|Zew [Gu>|_)M>ף?AV|q-kOKEXdH\βvkg x()Uqa OC73*)Ob [:4Dd%!!I_ѵ@ҔkgjUct;S)r[4zSJ=R ^+}iTrd"hQO iq46;R䓁w ܛIqL]rxR9UzҔ*zЫq n940 L/'$Їoӂ1ҌoAErmPrA+$>gGsk$M] 'ֆMDxY5f!zڬp=W>SQ>Cӊ㎗^ӭ^5mň<ՋZ;]@cSOuj8hR7 E*~5w\6ڬ鏕z5V'!W9_iqHFNO4LMC/ʡ{ZqteCuֵ[$q3*'U$m Mņ94ǘӃE>fW=ic8qZZ/to%nTGZxLa[nJcҨg'jpTkHUgqqh6Tl[)(0]:qҴf !o3 ,F$ƺ_lV~&`ZSt4eh>(Ȥ4ݦ⃐y*⌐n#78AShbݤ N٤;BJ "֤+L<`x \Rr:P9^ai\B玔J1ځE>zh?JCJwi(9r(֍ƚcӔzqMњvjRnHЧgYdd? Nj@sxw֢U`k6 ,>]5ǽH@'QL~q:ѣYaJ ,L |7fXhݧ=u쥐ts*Dck?KH_o$j= N+Ԅ!(r_Mg+uomq ,, 3ȣ*JNiq t/zLKKv6F u4p1Gj>Go +D\{ I$H29ډְ$v/'Zv5-]“8W5BJF7~"xO|~l^yb ϥy歩M]+yjmsVUrqSY0;h-q!OtʄOaWj vFgn*zz׏}Դd|Ȗ~V\pϽJ$VNy4sbۓkm:95a ;)J3fH})S$,nqڪ۹I!>ړ)4g+z$7k:kv,UxBɃ?Sy*wCj~֑ymySR^0Qrs5J,ry'^f))=^stoVN$$ѝ>nlU.aVd $I9&iZᘻ1TE(PƗxJny,EqR14 (۶\oʬ(QTãU3NE-j%x4+N4}V!Pǡ ǢE)t|2uj77w_CQi>jddkh5{;[6*:/%Fc?.>B}vֵRnVon TxH|IMͻ(+&8#jr;q9rrR,b 9sԧ)o2b\V29!U=c2nbtN>Y̋Z\A!!c'愜v֜յ#dW*"JN#Lm[T Ƣ)3*ŭYWiT)suCF/Y/yW.Yn0«du͚ݣ|qDtג1D!OٟU=WUYŽ$uf?οB&ޝu.ގYϥ8;zMQ{V>RLG?$7%9Sm1rܾW{ 'w}zKd|ҵRH T'7{nst`H*,pG#ڷ9ҳVQ?jWY]Ռ^fVz3sM՝/eFSwj[oX%}vȄ cGLַԬGJ5}%3a2pjF.µPL0V95>W|*{hE Jd[r"EfڄpsVe6#Ϲ5 I[͊P!B[mddPehmJ%^j&bxO5ZVl uu"UI.YFvr?֣:AT$.RI5us4ϵg\?ި+00ˑ?Ɲ䮳j:J>$'j[XU"UAG¡ bJQyreׯs!*BBk"妖]KǠpCU/}MgܸiNp*}BEE'O?0))˔9_^[ȏ&(&s֜rUSR\'qp)籧pGcB($֜\(qLsLcy4ņ֝O(,Ƌ]"aEBE2(ٝR5.,+r)4:+sVucGfx~zknD9XER*VT6i#Qp=ڢ3m85ߥ9OFYYY݋3iJd$Ԗ3> Dž_ƼV*xʉEiE #,~dI'$ıJǭWxw3DUQ5z}j晤CeccU\)C *kUZ*) ҬE^_O:(.AzSk Qv_n ʹ)Kq.^OҜzZOgQugZwEE-9 !DbZGګOң$n(Kqt$A ("{UܹP3IXzg#S6"+koǖc֥'? 䴤J.Xn&[8Iٟ޲^lXQt*6U5!c wɔ?+pW(MB}=bf6BI)5aUczҔ.8z) iT?atVϵ?㵰 S sMT|5ڡ-3ҥƜw`J; <*r?r>=խšϟ:|gdgn ?SJՇy6?*:}uSAY y2q㑚qڥW~/eM>ͤ >#K+;sWIfԋnʷ$PH"?.1VĨ[Q& מFr#5)F1 )iЮ\zj8eX4/ su?u}k2YV˟ZڬhatNyIOx O@XZÌ,Bߋi+tȣ)i}Zc?(f}m }i(oViwqқ2+ҹq٣4f4i2(qsE|g4+\ҫbE[Wȥ$TIx_ڝSNb6_j5q ^ZHW~oƸ*\nɞV..7FTEIk]NC2P~?JяKy-3~ư vVI5؄׮=?vyp3()?JMBylT!?.B51.!R7ʄG)Wu$~u]z J>";S[ֲA=V{ӂN?՝J0IF#qdeT6֗a'ҥ,Eb鷒O7c4IR 4*Ht7ۭ$򓟔z+F쫿EjA 77f}fS#+ODM8Y*٠.GPқtOx '$))vRnsGEQERAf  (DsLzԑ잂 nN>b^+;-M𫒞mu_Z~[&ОḦ亞2jY??Iq墤lF;/j)5Q#O\֋c]76X)B013ʎ/ŦD7+w駕T_y{05xw,w(pA+𽾛sjU\b3TP.#8H«7!'{r-(5nǷrҫi$x'8Sw;}&[\پ\c9>S-~Փ,x+m]@UN ayHcR]еce̢iXwZa.^)7ͼm'iܫy5BLuW'l5׊i(ՖT5x:U%WRWZEz;+m4zLVF]ߠxP'5gZ8oTĿ(?t[m2EsEejQG Ӣ}q[d|Df/yDA+ ]~*q'Jjq1-|)m**svs9ZڤW ]n`yTfW-yWNqRp:uݧbyǡUX2QQWm#7V ,$pR I SU~Ϩ5[ \@KyP=_n(R<-9SLPdgfgJTe*GJfP 8$nڸQ-)*nawX=_] e T?1;Q7%?^ĈPbH製04v;3B,q {m?#K6T*{S~SE#Qhʷʣ޺g8އO5(? V%].3TDb;SyCEֆM~U.ׅE?җ誣U1c+5RT65ΕX65{_#YGi116(]ܜZV+fWf>&v?N+2*z߲{XUWj8F:0nBI9'&vsX5iw{SyjԇRu *qһM|BCb@*܄5w* o)SM4V\RiqyC˒" a򴌥U%^ ]>cQUoJݤ*#*~\U+)#ҙ@T4 lTt(d3ڴVD$IOr(rm<~ w:9pkSiF?#׍[+Yéۄ) OBV-`8KH*lz_QX[l3>UsHBz>=ݟ?/^Z<|=>MCE9& `74"(`eP#OX}Ij|ݞޠv^S.22AIslZ?~u=VyT\Sd}+5J4r8r[ut{wB:#ⷊ}6 a`X#’yUSh5mcNٲ2ʿζTP+3M.d5G[iEXEEȍc,p1m:@z8ָmĺ.[O^`eED68Jsڇ)wRs)#힔`UGHq{пwhlHOڐp*GBv qy1)/0i\<7nxIqޗz *2;RlʐyN?'|K}N `H!lөAy({\/z^E'{R"q4&?Mnsȧ&;(H35ZB\ͪ+Yq6øn{n!Vx?JßX|.?tKDv9*kF(*N~ozqRp{;{ע;m \ dj N=jx9s1> L47"yjbęy06e".V>{VjOO: tQr:VҹM&M8r!^='+Oh YܐrT,ԃ+"H9o/bk[x,YS>YhV-YQ_:VVJFݵze|uQe|ٳ @+keR{:zr^}V Lz}X'RO޻: =7H}i ZfqޔJ&FqKJhxLhUSGZxr)ރ9qFpGRtQڀo)G'4^3E(?ʅu6 ERe\UlutI2078SA$x;2qi"vqV%]j=zדZզ8 wKm>扽)tM^]9hZ}`Q@܇pi-7(ASıY1~bBpW5qU:ĸ*u.@?Ҷٔc7]s\cڜDvH۩MԞDdjy#>AQ^*a3vxs.sqw/zۻpkڄdcd<3pg&8?) [;zh!6`Fe?wj 08&XM=?(#WO;cNUd9ƻ}=:5ȑKΚ:VTuk~xIA"+~WcJ9X\)8֙ZVailmz Ϫr{gSTr>\SLdҍ.S/g`*K`Zxu҅$V 7Qw+s;kBmxű\aYx3]Fwk *Ae`㠥nGM!;T lݴoʤ}j'V* V3OJIOARI$p;A5JK{'k[BwO:WTc޵Kh̄rՕ;=0?Y^8%rv"LŌqRr)#=ߥ(bIoUO8$ANEdvzFMs;3խ;G o&Õ AC-I>YǨ<;V!q=Qե9?= Bw, ~0> 68SEGyaYʯdUqUR[#Mbe1OScβ5'$U4>Χ,}*^i:[* bj*L&. )e|3¿#r~GQ2\DZ!*O?١ձe⻴oF_3у2?3$y652~1H<gw:y'cR/y ՘okWQKyg!*c0PZmuSZDsޣkUxɞ M"UrLmR~u WI$vC-TqʑaTmQFU!x88@HaU lrk1v~(Vй?¶ g pC}Py/}:#[xbB?FNlcܷ4d0[b(ڭa-ݎyl%pLSޤ}xLHbV_x]9}4,+Go`*$B\k/3g-BT[}ʸ-?²w׍rhq29K2~4ϖ%G69$֦4g,YTDJߙ]iRţ+\Š(@TPO{T{pji3ت5}%}HYU'ƛN>}6}qOEyбUmi.@~kC R` )UI8PMM*gk-ㄉ~\µGk(=Iil#D2F5HW; ], 函SD=q:w58)h@te>yXUWV1F Pw}k5U$&m<=4k/[v}% ݏ$50XLWo_bh}* 8-̍ԫ?}Ӵ-eHQUWAkڡB6 Km^iǜR'#Q5^YވjlUMPJ̸UUv'T4D.}УA\qֺ.; ?2.ĕExY$5Y$|~OsZvVMܝ(#z{W8O#h@WabBޠAj'S* {tv"Շ>8eWLVqZr*jwVɶ d}լyg&Y'JxP#חmIT/v_X-]UpuU{B8˄+Zvi+ds}5yqH,FDI٨4ɥkFc9HrE(z\ߴ߽Х._r׏DP^I6o޵^>뉝UjQ+P5̮~gs U>*Ӗug-ٷ? ?՘a&k>Sϝu3;_UJ)ȝhAޙ$:{ cyJ}ؘN/i ԔR;bƬ[UDbQ#hlvP"0O9 qZ8 _+T5iE)(~?*rQ"vWlczuVl}8CO>XX8Pn sg^3scMXϭWPY 8^[s'Q=_:o]2Ivʍ'Z#6K5Fj C)9F 4}zɥ}Z{ _WyGO_C4}/z>/QQ^>y>'?ϥW/M+si(攑LE'>{F\IE?wdt} QEI=֕X Pi(@j*ruV;z|VeJ\vC%Qa>yvnYTʟ*d֣*vcNӑT! ʰsNom&+8ʋ{2K<8# \7?UJ)wrOYJ J㜞ԛ}UqI_kPі/RG4WRgR2G(QKh*E'x^B0qES_Jq%;u;̃)E+jf8;0uOi;}x\[M򵡁c̝:p~"=ݵ͡By!>߆uO/[m[ SWNDd=B⦸Ӣ(*S\Br35nn[ [d#RkTo+qߗvܒERH߻֦G$@T)a`J|,H.0=Wx%A&kaoʫVݵjv9%#]kԧ(Bʌ"3mGz~ui-h]FEcmAgߥXӧH1mX[JyMCyw %p*-OQrS=坷EBt\`~5#I:;h#*>qUjUrG5n [ko(?3}fz~O옞@w[-dL;I?OƲu[¥2`"zҺ>;H6`321j ?0I\k皬&G/y}z-3^y_R6GjojO4(SUI<Ƿ?Am"XH{*{44ؼ=I\qNѯ֧mW%^G^ro^t`ڜuy9O1z|Rwcs j{zXCSDf(y=&Oh̅ZGv12P##+ FUis*05[{rd]Nd^<ى`ͼҟ+ܣH \TGxWH[!mUIVCXi^.UB5 M&A V,ldn>͟ty%f`\+\ScɔI{dVԖQ; W:\[dlu7ݍW^yEÂO۬L[#@_?3gTo,l {V|U)lsʩS%2ve".ُșA\3t7st&w+sy/oҦGq3?γ)0W%Mh<'Ȧx% NCPjzUb*Jj؛Dl4\'ֲ s5G9ڮ.rO&pNFƥӪ? 'h?.0EL*N'(d!6v'$Y\sUGj^;Nv) I])P`W QMl9A[x1P3Y~V{W=E OV=Nz{b  әuQv1{ջ=fXʥҙSH 2ȭܰ Tq0xݑTEHOҠdY#^sXJš*{TU˝6{vLaglmAZa Y!# rIZPfXU58"\VJEΧ"?({V^-cJE/z9{ϕv] ״_6*rhE7`%UQci>[ʡ?*Y/cgcמ˜̍q",uf~fNem>c| K43;/R*KkW/:c/>sk;\,£qƟZZyaUzn#rX& VUPXFMu~4{?:|ˬi:^謡Y$^2?SIorDTN+*(m6=M,70ܩ'?j}VJ>\ %!]_cvr6pA]%|g5j6ycH=Y݀1Qϥ9?$(84a FeI虝>gnGڤ3U\3Q2SJbų]WT?$W \j}.r>,-V_/ ۵DACD뜂Ҥĕ"any=kNI^ T`*I]dThK/cʹ>_j'fE޳Nlw<~!۴?J [9r0}iZR* V+Zv pSYV&Kx?Y?@vc?k6YbG4A~ voNJ؅fAfO3+ oFUÖ?Ԙu) ?Z_e`jԢL :ۭT?kM }RjD kY j{SZ >ziۙqx5hOIn ?)RNZBFvbR'ovmDEZC Q|͗V95\nZYHʗ:oj9#Set^`>׫:u*ik4 +g(݌mmbIpǯz/eU_Zys;9Y6OL5PN<$'n v'«RpU۷)^,rW] 2/ ]5SPkId ljX7}џIa5qOzQPߪj*bw2+ܨm\wZHgo5 eS,xʝicSԨ_+ݣY]8x#(U"UX*n&<,csm[ڊ2W3HdS@>WZmJtzPyP8q"O?AY-6V%?ǖ5w,-mwO3P]Tu%"8_V7w&/UiIS.wDy*%AZE-y1W:刟&XUXSb= Ļ]+"IR; \ s>GWT ttܵoFGY[PvGUxj |?1*92jR;nr}MF7qG/ǩғO%"N)2sUm>lt6QE/l ʜZI~0ZQv&!EP:b@'&1XX(nc!QBCҝxDPT_qR^<[p\P̥ h>{P nO9#EUjޕwJGNh9HTzy+mrgIBǹJcgQM<]&YFރV,m@' e?,Ԯj9c;H?Ux.1W֝+cS/uԣ'+D{tS1LkOv~TЌ@R?Y+8S6K_qZ,@)Si>#QA Gi|vSWZX[#5\隚"$ 7X叩q4qߊ>_Q\7g%9}M=iw'k QE.sE&W/GQ@&iqAԀ(AGQE*TIP[KSQaKIELW#֪Mӹ:zUN带-QYkXQ}IJ? ~2?tV$"TV^\u=O*zs0goe=z}3}M?F6~7$t]hA}Qt(#\HYJtk\F3]KBAʞF*9APyG;Z 9 Ox'B=t#iyR4„z*{Ƨ8b9$B;NQ!۟4ab|11 }Uik_v5Sֺ=n? 9&:QVet5:#_𩬥k>b15Wq y>W9Ls4xjmvs,z?}qޱ7PI,LFT=(/w9ܕ~?Jmi  ?Qަ-l! J句e:Gv+?}&;qE;ji S vwjK|֡ JcTOQ^%Gfq yF=ɮJ*OEFBjӶĉqʚcKڟE֬_K%F$mzSV5(}hbl4J¥+Ԗ0\IKA#'@zVIj|XOJpM;#44\Rxyy\)IXǥcl`v"Vjϩ͓'l9&Fbk2Ry51,hQn&XRFgBz~Y[[VDYQ9d ەGCNhzHsy8JP,~gS7Qu}+ê%L{ۉ+GPÜ剮P,:3PZie,~d)6v-dU'21!cZ(<sڨ$vSOiF)G? R\9!)cBL%U'QBf yZњ9!#rUH*zg38WRe' 3֪b<{洩taZ?hKg0$ngӹ;OY&3گyd-]U%Wm8N* +6JbȢbZr~R\魰/je\N)n9ę(t(>iheS JnOC  ;mUo$y+,U#Qk~"6WgyP !}=)hj_?Y(O%HK詮;cH̄R}*Ê(T[1h$d4t7X]5Vz4VjeW]Vh~ޫwW9tNXsU͞s1D8JKW7aeTƦAKm-82ק6FO7{13mcvJu%ґ$ Q:dUN28ҴGS8R;6ڒ<J̓A* V>ƝJF&¨w{QJ3JEzRs1An }GH}(ނIZ8Goz`/$Q(;sK0vEF1I)Mga@RZQH6掇IzTqJOƔwZ\Ҍ 5z[Nf֐sB7J:y1h\XM@>ݹLu^(N$(Cӹ98 H+ZͿ+kKn@bJB2QS.H%܅xp)#a?LZҼY\2ʗ*nȤ195K73uJTQE\@ U|2yrv05t^Y>h|e8-8:\f.I9⸘$0dvλއ*9ɝFqޤ`I+p;突rpsDVl^2U2pIrUU19FPj9T[w4jޓw<5\+,d(xkWAɄOj4@8iZAis惁KwҸEԱcXv q%Kp0,F4w0sd`OT)V8M#tcNYdR0Ki[:\st;brsYo`c)Oi&)zu緾k,D?/ތW:^#LY:G!Vphr)&byOcPbIaDR뵔#H`pTc?3XF +]M3!c[=jr$=TȯK 6ʥpzTV%С5[ҥw$z쬞m wc݈(.Xhm{5bYO?v$UAjsPmQU{ $\ 穫x#49rw溮eXbCySVSYo8vh̑ckEa,7!a$yv~g.&wtBo-3Ŀ8/cvrUF}}j]7{"nxsBkisR(e`GPsW#ܜe91TU$XiWƥY}҅i\N֛Q4y ~jKxbr|'γ=vRI)rTM е\tBkM% c))0x5 m"^6/ M&ޡ(P ZZXݾD] nc?tߟdED2DEK}OJiS,T[3fM[OJuBW9!?+i{Sr=+TnB@:҅펵8OX84sRZCڣ{7ԨѹP*^[RW3U`eܶ"aI䏠ffIF9  nI%c'Ҹqxcw5 -IS[y QO?IuWbXa&ؤ+ZTa/}Zі%jM"(̗Qp )%Ҥnl sk^5dXCMyK:jzj(*u뻟ҙ"B7r{SZnWffqsѨ؛< :/Q/-IP|zӴPKaM9:s\_sfN2qIeJd֧9%VXQ,WFt/iݜcѵEEnYmcR{ kM0U'J&|R*I\Hٶs}xГ{ u^Z9K+2;(][[rڲui6QkVP6 Du-$OLEJxT>EX8y>_**/™!^c袊X/x?Jn E`)E"=@DDQEg8{8v$B(҅L ֥|ƓMT2F@=^ sayW;P 89h?zqO]MV<ɳthsNʵ_o2}h*;q;JK<[~Uf>AʀTpOnͼcab;*CH$#ƠJcXAsօ8IYT#ye.RK<#_βAaHP)HsYuOgnKrc_9Wns5?Cczӥ6!o@[S_槶.!*cRSS!a!%te4ZFޔ&kuuK%6d*Tͩs9fqAZ}I;u{9ey6(&>O?Oa+_xY_៧F~bTjc EHQ~B=OGoO~TgQ1LG-I?Ԣ7|S|OK } 裏AF(4<w MI?&_/g?o8qъ1RO/ 4偛AS_qJBǧIUB{~=ݶG_?R/SQ~/+ ;ojO)u,8 Vb4GKzLSkgfg[PctqN]Ik|kmmlb9XhN~]h5s\dFo5Qʞ~\(ڒ5$ ހ}8Z# **;jj+f~w$'FNӁ7av*} 8-br({Jmu z &x3]ןzim%ϿhH ߡ}veE@}kJQ(b}S xZVznǍݻH'K8UۏSS)YO̤}QSr{j#V&mj^s/4 ] s\.zCTo nJCT%EX8nlw2 8O.FCSVx* 2H^dD˴#b(HVW@e ̒G{ߌ(1RD 1Bơ "*"˞s:Z$u?gJX)N#wwBHTR&׳~umzJqd { N|Tft2@ۑTsGVC UhY U+k eq* +o8JHʓ8l$=+cTӻ6mBN͝f eUevܠk%/fUcZ>ek.x}끼dU Ufzղ7#*YLUF%P&P.>X*v)69?LG e=HӸ(.؋twd}76Ny* NV;X:e5+ӫ+É]wEmd";M|ꎂKy?5 ~Ig_RD*Uѭ B-IG'?jo/%tU_Vi,|9'EYڽqY:h6NJ I⽜0ׅn|4'C?LVWĶX_Wf#T⓱ZںhT@h?*n1Ghn.d<s@fqQmUs;P41qK:S{g^Py&vg"4ޣ8摲\/sHBc4^ E4;HnWI/>ǥ/n44~~Z~jUZcLUx4S8KF{J2iv&;wbi9GJBpi%m<)j X25SǗUn <6+uxo+IueeL-pAԜזyES?7Wora]:w_g-v tkğOLj:iWa˺&wj2I5 Q^#>Y׌ ԵG\BlY+U+Vƒ@SnEvr>iϿ#ޛ*F?_үi+TWJde9QJ._) 6/6=)#JHۄBGa I3ڴO+٠QڏoJ3)'4*vB9<{hi“ G=i3N.9hF}sJii4lRB)pizԅv)=w }[TVch<):yvi yie̿wW-'ܙRJ]6/ʀL.l}P^\jʻs4[ԙiVFӏ8. l~TSרdIי*+U_qZA Zy8D#7rew2Lۉ|.{UW۵^3?zԴ]B%VCV.]~ZW4@p3?S#[f2i['!}ۙiNUkͩZrHaZJ-J19bEUF-Kpj)_&N1J4R>ݨҸl |ܿ(P dlU?_Hͳr1]sZП%.^n](ۧ>VdsKm/ e& &|șNeFC98;OhpX"g!1pַ594ۖJv׊bbu*r*^MIp~vajWteVKZm~ҔGڪjMp,9^9d(8jjRL&/ i*U֙ðqZvj)oP8+Ru$czIWD(٘GR[E,ҬcC}vqEag.T^Uqo}SYY"DUҪA;C"֬唚#\*30ڜ~u")`LwW#[mp1OlaB]e =VO0k1\rJթj2[3OqfS*ˑ{Ս8nߕԡ^b^#D|{4(}Zٍ O4JY@-8lxeEV뷝aXڃ&&I*pAa*r/[ cҝM!VsNIOʥGri63ɡWoriHamcO1ӃV`vMXqMNMFqT5 lQhW̳s"9J$ׇ57 s0np>mfY^ g^ꛇ)eP AkMWa-[ eR::rhv goάGz~iƬP_ĊAj%SԼWK3<RnEYyRʿtV&m 闋qc ֵknJX;o*mn1cOW SϾ0Ȳ2x?^_!~sYf̝qt1dXש+&/+;5|:TVۤQF*-FlSub ѥzZVWs̭) u4I<ī?s~EZdPyjjBRMpҬ2j4XnR%cFJ涼HUrkP_1=P`܆UF8AxrF/"˜MKJ,*{7j2iLHyVǕa2懥ϑyq=inyxo5bFmQ:) -| Oێ| ?2@SؾHg=53. TJPنmtՃ@YUTrOAU)-QTfcY7X}*6夫#F}Au<:uyAzt/ڧޢ t^5Eg˱MGlyΡfoo!^TZjMKTϭ/hy/yM8Š:RQZQJ^l>Sa*jegF2>f-i:i=UgG]>ː}?ջr}"#qڸR>2>j[=h.NZ)߄Vp3^&𝑚v 6Wk]P1n UpB8ȭ y<=)X){R)6+[{1~R lɂ=j>lcpkXIT4p9rNӚyF7fؓTUT J]X"$(<_>~f}MxԤi-Fdm<JC~ﶮr=iI5@壊8*((=E'(ƊSIKRcIKE c~t~_%Q))HQZ1E*nz9JPqF>a=ܼ54o ֑$KԕXdvjC֑2?vp)>V-IJI1?tҁh5r֮dYe2~SںhVq$mJvYm/I:(謄# Jm[Y~LCWJi ޏZ:ZvH<㚓<1MBJ1!XG;F޵ຎ!?,==jɑeB=Cr E罌w[HU7Grtr$Ӎ"\! eBBMz$GΣՉ)?A ]Hr BK6 ׊xlwYɭŸQv;̉wH/.k!C vF*O"j4nvPR׈^#Yr{3y"&c zk2哑\ʝ0yVw sSZ;IffjEU1qUY$]M]@T>S\A)SMn\jZ2Q9;I.d֡IqX ٻ3d&\ (^u[sL}e#;dEY"'o ].pg+TnZϲ<ւjv[13}3 FyBMѫ5UFȈE4T19+֪҂Pn͊Ζ"cXF(8ۭ4zP'VG5gwU_EjWC.AUZky rK{g.sN%IV*禍c~40/jHhl) @NW─СB':ҁHq)JJ穠c;vl*C $c4~M#iI'o.x89wqj&+~9'8rʨ_٬<,^ܪ9Vu!ǖDN1\d A\4EUgyGǕHxulTpEMiK! $µ/lVKG={ZMLfj B&j(tyO(GXpAlark4eF,O'q媃x(%R5cm/V~`+ saFkٌ:ՌK-tK$$0)SZ<+p4NfTFHQ/D?2fI1'nF:㸦=*XOÿJr[B6yYW֋"ιFʲ ^fxڧjGnIgVt)[ܒ̠|J˸'gyj8y-!ݹǓT48pgddcz֒hጼRqUol זn}낽:riOWӓ\ھ?b`w1d"9egʁ]>K9hyI\!-~W Unz֧F([YNO](jڔa&=a'bK{KuFKyp*}U HBď0>N?C͢`.ГM;ɶv@9([N1c\N=OAOI)*HV~N:?egb<|6+ڸ-v:%|9;ztY5/ ˴aVƷmf>򊠗O{K&BU>)b;ObjT~QQ])#O =u'z{1Zs_WRrh(+(C&Gvhl], ^\aT.5`+ң'*#%/(%;xKLiH"09RS\|I3nFvc]VM>|aqoQHt#p*lMsY_FWS+$8V8pf1s۫цZ$aSVt6J. ɏ?ľaQ>w=ϭ2VD%YAj|79/{w忩T\pNsm1:lKR]@`T{XY-YyEq5u(r?w2Q-޼U31YF'Ԍ(bB)})ޑ?;K`HP.pZy=SM'<vУލ7Q {Rn~+[ڟ)WߔV^m23Čqǎ# VZ%Ȏ8?хcp1>k#?9a~GFj;x s N֊ho_v83zRԛIHvIpycjϬ_kw_~S5?f|{?^,@zǤT؟?¤Pd\(_.=Zp i)^ոEApNYso".}~S}$G]U'L* RP~"lUwVa|?_ΦUWrzj/~#7{Nִ1p9Xy5݇ԜdU'SR焷"#J]*L2FžRTW鮇2 aBVR 旚ٹ~A^A&N(vG~RvH(&E&1@4)qߊ^3֔zR~ƪ Ҍm"s׭p}jGٴ0TRzTw1Z\/wwCEM2=ĩ#Pwa, ǶOB(S#gf{Tnܡw2m9$xv/-vy{e _>~)G.V&%zn#S|yخXciCM[e@vJR4-($ !᷍8f 7gQ68rJ!?3OU*9l$0v"lN4ܟ!W^[!"vue5F8}jt@^NzD&BҒ?LVͺbS}HPGqvxSE5kbBpsRċ K֢Bbd ԹQUNy<»nNSy?v-T^\~^{BJi7ҙpwms3jD`;sU)i7 S g1Ȭ6+W̜"+:NשMe;rj6AԞDMLL)Tg2R{v@c_z3Wڵ,(sJ N;Q[)A8oCWUŠ(yκVR>^:-,dva]HnYx3˝+pGSץ3l#p{טvB zz2i=N] ʔT0]c|mm)WΥID=UjӚ4oo6(rib{Zc췅lяPuw3Ȧ"bs=0E`\xz%-n^'Ȩbv bn}Gzk)P^ؤnj݉1[!sӥ!hىXyT{E̾ⶵQ-ţ|S1U108ݷ봭>8 "kcQVuF8?gzm7&_ƬyR?Fd,EhmV4 qI*(o ]C/pM9m2,{ f;TcO.5XOOcZ{6Mz)#ҠOTnl«f̬~ зYvǽ+ɯBbwƝ[W}K$n2c;lNƟiaUn>é$;.Nb>,3aLHQSh^*ՆZ#UҊpJtn.4͚+e ny'ֳLDl6L;ֵ:ʎOGw-`y 2`0zx9,@OQcUmvs5\nGJpGW*RN痈8Rx s 4fB 1R:8J{I#+]QjJVJAO,RXV#7hgo;\rXi3IW2}J.!5񥴆{ћ`IVVj3О椆5+tl-ex#?UM7<ֲ;rUJn08 zd\yLaI%,l=k&@pL з+KifI7/l[+9ӍT׿k5_cR)8ڑƇ`NRf]I#=**ʉ4jbnQ .n 4g*iŘ mˋCasooVZ?"c.|ސ\m'NE/շ9^IdUVG\c5<$i)ᶶUT.9˝P0_]մNcnN>mOȽ}Wp*i2K#-W,.h,e9̍RHGAM1\Cs\Ѝ)n#QQ,-s:6JWݬb oj(LښH4n)PEǘGQlf5("Gӓ'Z01HcBUyɫQQZ EqS$[F <*;ᵁE4J̪pzk PoI$v{V"iUĿ֡F9,sf"=űb+; +M$ Wkz$"W wMrrv~T(<ڰbCi~=;\ن(3HzfxcM7ç(]E2V7<ϘЫPH)+7!}9Tu52+"mydXڲhmj0Ho٣5NA1 _9+0d8+Њ/yr|zΌFS/JHY+)V I53VM4x [O2x$v%K RmSVTPO 1ݷ'SHZb ("bcNڪw/J|-%pŐRe~^GJ1M<9+Iz ϕR1Ӥ.[~k;旌WygQKE%bZ)(J(:QEQEt (((A(VzΩSF]ˌjUrG?W+bNA?4`E.9'z΂Oin}o><W.޻ynuQ7: z!}tWכ(J;Woj˨3.#7CTm4|vZ5kRS(Ԏ>sLU.Ė#tKIV)AIrTu}95 S8h{cj\Mg&'1|qU5 x j@?x cOBv2q*(;VgȒZJ^3?ʢ]v"PxW$m7Ry WA) qTf~RpW5?gI3ɺBxf1E2ֹK9xm1${EF+8fy3'5NJɳq֑2zfJU -w:-d)+'VP6rUA ǩ>(Қ8֕QE>ZɞW< ձct޻pR坎#k}*,?UJ~SJANzf1JiiI4v'ozZb(AZ: ɥh#&Q֜Ҏ/(L@R{Š:{lFiNsK߃Aqhe>8?(izq\i矖as})Ӑ7%O'ir)>_NZdJ~^c+hsiUqɠ.Ni =6v6*QM$ӊ|;W9[}MU*[Q 黻Gy3 }\hbc'jyjr ܍fIM ]f#⸴&T,yH~6 ūWVmKO$ktTBC)DryMnBיdqs]1;V~Dی6idv\I;P1ǵ=n "W\4&xWbp'5Myn /q^uxTϗŭ }bydq"M,U}OmjS\ s#3 qҺ=wEKD6v/k_;)2+[upI5ɽJtL]ARH#r=%(*tnW1MS,圐+*3tϱs I ?Z!?ҬR;v4g5(_SSp{ PҦ:tW1bkt "+m9e6o㼓zŔ+>iERDVS>&S MR)D"y*Yv\9t)Fe^4d}k.9ՑVְlCU"UH ;STAP8SgSOF4cXzQ9=/M^ » !GATm-8Lk'J2ǭHFOsL$+Hzf323Ҟ{bHڦ4֢S+D-2׵(Y3R+ dSQCJ:^hFE1HT04QdI#G @Xy`fL*~^)֥wV&eD;;-fj1w_J׾D(ç+X xnGٞMzng;cmd;+V?>9;}Wp"Pr*4So8o!BEWZ>)ѢEhida*:lv1J6^.ilS&wsگR٧ZUKd2Hzq2k/Ur:QI^C˝FIr[,OjHe,p};(yҦNx4GsA@S ;oM&ˌ[ҁքCb;^~8OiMJD{ڣ5j1MiŸ~o[qxs`zHAJ֩Ϊ'"|4m A vƄjUluY3z StotkEܯ隰5TEQZUn f:̱֫ ~K>O.OqW OGYN"0I&1:dRO$[Dm_SmyTu99aN]*y/*چSh?#]+-Za9Kx,k5Q ʾ՝fSA+ҭ G2 ۜ䞴dH$"BFkZ*(O6|2?/YO9sT&NNU9@'K4Dq'Z|+SUd*( O.時F$lsk&wo\"D'Z>&ER*?/^6+RuzWC_ik?GV>-cVTt*~Hz5K5Gb)~H5 ē/)0_#o_0kU?sI_y4>/i<ң1/>ox:\63_<џzVPZm#MMc ?a?!?z\w(Im*~AP'7|Xg̋5t8II-)'x_kMɹPJ7j歀`Sd!WZPAjnn3Li>Xprn#<^2I-4̏AJZjW6w{Gu6ʷhۓQ?U8JEG45h=OGz+<ӊ>RQ)4)hP)RIHEϰEf(PH((#B}Z^i8 +(?֌#pQݻD({e\SG(<ҵğ'=Mh9|ās|$XlS5MOh+:OQNю mȦ`AZwٚFqze>=2̬UWNS{V4H42UDe~luk؝^^_v=9O\9/cܻJdeW\jT]J II2Kz{Us(*G^E7'֯( :5 p$D BJÓX>"&&N39`2"h>l֭&;jڕ 6ʼxY_ ֢37(URAa]Cx|kA5\[r ҹ}Z-/cP˕Qڨfukqq->UW^ْ]xkȯUq9e{ I>^棧ێ5YG_-ϑ8 dعj~r@{'ds\̳RBy~:SoRo>ǽJdWTlNONy-)d2LWKHѾ[U~WST\J$'?t=+:^4bӷ7⪭}i]`e%3V<%rlweztn٤zrGlZJaL{pO= 9P .[R#rg}1@84'w;(t$sCj(&=)$b^MWLv_-]~JҒ&BYUKp+k%%2[ڛqZ#-Y$d.(ojK7:B,,mNAjƨx4)3ڐkDiDXzTȊM)#8<Bp6'$ <I~`*qԬUT!Tu$YnS1`Zo^v]cS,s>a$Q1(i'*e6Gy߻G v I⳯u]?1ڃ<~UWY6zGaY kS51I\*$kB ce[!qlK+o2˟i<ݗCMݒ7Fu}ʦ3\>WkibGOw{:%jXV,³]R9kV5U]^*ҪRL]G_T]iaW񟽊>A= mv0B?qh?P*n_zPJB}==jXP|Յ>PǘLQaB &֖sH$EȉnYiQZ[֘Uje'nxNx-4^$)r:02 9C)Uc=My5kTY; ?Ox9kPXb5?ų'Zϸ\$ ☦kPȮ}XnWSg=JӍs\22nNvvN=*(JsMcyHh(ʪ%Re_F$^F*juHpI:< Z8#N\]Š(j\(|QE( *a ma$ve}f2vnXdOZrq\U1\ֻxFk1nĢ*"h4buQBC?Pzw[RRQ]<}\#5c ;\Kk((O]*oNk}))V)sdW`ULƆ"*ϕs ~ٷ9Z&ciqOT Zъ FѾR(1cF[۴cgo 43O*͙ĩQUMHOAVP}Tm'R.|SG|ѭwܯ9S-msAұ\Rvi?ɧ0Q4M;ޒP7g׏Vn=yGvݝf~\߀zriGpc+8ҎUڸ{Q[[Ʉ., =O]}2O+u-m[U$fއ:igh*%{{:-IB*JKMH›cRĸeFOwb=v+4%,݂VJE^oRSh*Z#,j/ d\yg2cR֐b4-TS xQ3=! Z֭Jt#jԅ܅k;vv9,ѩɩU#vE&NE)YU{Wx ڟtmI=ǖ\c|ei I_vI,)b+:DV?ڿM=z֤ZOC$Ŀ4XD1v՞0T8`v].;[9s ]бdfG^8ϐQ}X" AWUs3aPkQͻ?짗'9Fv X3VHem5dSVi"+jkwXÎh{VƑ.cϭwuuwe+<9wVǺ/}^w]')B6JsW. cɬ}No&VjC,ۧV5Վ终n;Yj-ܖ8^3ƺ]V_b;KܕfKc'9m"^Jr"kGn)`r#J4 !~V#WHC >Mszt;#\|ؼs!*8?/jUI}&;b ({W]U ևRPxMhXHvW}#_#OY5yݥ< jR٩̀?ҪEssZoԶ->:"\ aZ5Lb>~C b0n惭}[Vy`t/?4M_vfiEO c]{IUg*3jAC{V1B,xSL[@YSO*GVjaZjtLxԧ OC'5p9 O_0f`;0+\*y1r?J@Ue}h-Bgh9+QIr@=+[i7!d+ٲ#jN<=ebM3 R)SWzoQUvMhrq[OT QST<8 zNRz+nLe"JvݞjkT'I;v6zS`!y=zЋJ~^1ڕT(VQW iFz[oqҽT" ~Z0}Ӱ#zp.i랔A#=*3Ll*3A>ԙޜW֓VLFqL=F­Fz.*f2BZ;(Տ,(ԏ,Nx s\CF:kQž+c`HxS1Fy*"rz(zxGN-CX_gkyo"1R2R9Kl:3Z7yFk_Ӵ=X;#Ur:}bYDM~;eU"?5_LKO +9# Nvs𔷷,̪8Ji ?J,42FFkQ61yMjnWG,ĮI<9*4~GПRd"GOwFWAu*94ÿ֦$UxPW9滪aB*Sٓ<&qMT4oJ:}+?gYݑPS*$;![VxP͡5'GAT$T$ݨ֛nк %ڢ ǩ51i 6_5\zs3J嘖c4sھo&|n.nEٕV#QT)I$䜚JhQc{%rjBp K 1ӚʒMFTJcVQCJ`Rz tq; f'R@]%FN +E4w\WZʮuRU饄 !*WX2gZIR4$뚻SLgO_sSxY:D ym_Ηoi ?j}r]KB;w_z_/05_&s$m9ooU?L{hΓ84Guq>P5'n瀬Ex:u8q|!w70+]@'j3Kc<_\Q⹣TX>5[#۟ 꿴 )'O,'=No&}Fp.$g5AEŵ^v6fI&6?_TrZ n*/aVdݓlHcZW!,ǹ/:|qU>X]Qٔ$_zM{bX]y [[iOA+ #kyn%2#H՘k*⦊yʾ5fNvKm$c|p/(/L (Թis=*X"eϢ2CzQ~44-}Kj_`~*DxV.=j$SCbja@tѧcjp{ K;Va֦o՛MQHyZiWoJRw!R2j¡vUeԀڗ%N2J15t* #.-oeQFzG֪# BORM(yI=yL>`{SG" cԣF?LKVt7&Ux1 KUv 8͏JgҞ:vЕΪw7Sc]8lJ!#-dtYWe'Ӻ0X/ғ{:osHC/g[tè!AS^8?ʘzuH8iJ1"dp#9fzyCjvrqE߱1UOJqXTbz?{H 'ozxOcqS\ϩȆUTDC$Ps[>9bQI%Ν%Y4Cǻ#aG<Sq41JɞN+hiN%4Ud/T '':|Gztf8& d[XR5VKq+Zv|VKI)rƘ3/$LrN ң/pM1#=+1z.bYC 0wZLnokK';ԁ@MoA李8MH(Jc"@?QOoLqQvaZ x-< ~r)6O$uE$G>lcq$gSN(wG(J~^Ċ8w,71ɥ?:n߭&McФΓz(o2O҂BяsI$v ?I1mߧKڀ ?:i5̍Q~ ME\̈ 3QԓҠ7 !noQDo;\M#^T7qۡkX1i8EgvTdxZȞMBCYKujνj߾oF$nt bX-RteEFab4r:o)qF* F\{Fi"qCBQEV+D]O;AGb#N1B(!,QE bI98;F'EVz}S+>W2v,@IW:*.YF:QE(EAEQHhQVϱ$Y\kmn2Əw⺟ yֆoʽ%'ަԦ,mcx/ p:ji>θn .~U;Mş1VO-<+{WEךlVR{{W¦ҧ9нmho3 ԹMZ.q"9L+zf܅92\ ;r~V'hӜўd~aT4H#O$>j^|q8Y#]{WhuV}ֽ ʕ(9UbXg)ڣ4Ȧ7Ҥ=)vljbjn]ԠvʂzdiXl4*E9$T2i]Yk"Ki(9&&#e?t:2}OA84֊?GE (ZOBф]•ƒ߷}랣ҧ!vTS= [ڸv{tw^+_q\2(n_Uucn=is-~QҀH[AV$(E4JsLFM(&4uE֎SR~()J[9fixZkߥ2UU}+m< Gq;qҝJpx80)8M8i RF;ʜ~_֥ܖ4kiyȦlzzmii0B*~4d}ޟґx9F :??PYdewpQZzr}ى?d{x'+[?Ng()WoJJ*}oafs$dvfA5F˜FɢbY :<Ԏ#,W5R`IcrLV"5psT5KJTFvU?עFVz  T ;ّZWQY۴ȱ\AG g%{jwl(=樁LQǸ_k*kd;PXAw;M/r<~'+ǔ9]5~mDa&;lZTRzWtGgE6ȑfAs+"'x*Tm_Qzl; fΘ!ﲔq4,}f[4,s+]tatԯ_Pͪ$q-Cmӽ07hl)3Y٤?9'nb 좻iS妉mt-;~$3/Ԟ)^9'Mw~fK̮[?#y?v̬'b{V]ޢ%s{'l 좝 Ȥ\Mz1ӥ|C)ǚm{Sˌ)9XI ǟZU>@@F.~;T,z h9ԉ$/i֫#qPgqcOzNq|be[Bv:ƿ6N¤3SO3optG#o ]_~j",YDIyO5ZyI7÷nI#TDq^\LۃE ^[%۫Fbk ľx'l?zَeG\=2$7VL=EgKNsu\G*'9?ݫ? ?'1.N{[1ۤ02Cڥ嫒?Z5?u.qIL1PƮ5ESd>tr+5z<ֻl֐\NџU+.}2Kwܙ;_mZ{L-4#Or L_UPG#/N }Hsʣd n\4=sCMѕgy-Ƿh."!dPLK]֩Ig$z|{o5%l#(eȪfc#BKu>R[B{c4kV2_P:Uӱ)Y׉kicV [˸@jo!.Timf\INH)YI^qYT(J 2j e˩nGAHK}Un {MEŸ_ҳޑ(O%>X9o`u^$ӧYO-$K#,}M0s{mH'֑˹4f*F3kcYX.y?ARvҜqPT[SBo+hEu%x7l\:y8ؘb =:R1La-N A{d,egMOexPr!{leLzwTTG=*Y£a_j 1m*pYUsT!Qe_q]#1N;ibζIW:BzI̤;Ko%OASK~?_]EҹUlaW443kHRR.%vƘжq.i 檱 ϭm4vV\j)e|\y#UxbҨlhX|yTrZ~Qmu+|/HZYMB+O!fX;}WMth8~K 򌰲vOk7W$nFo{}iڀckp?5 RͲ5,I\Ѥތehw/CJ4kҌ!񹱰oI?_ZNp=ϽaiͲ՘3Q%Ո,#ʏ>lm<;8uʅy;gƇI:Cޕs~z`axqdvK5 99?/QM`W2iʹ‘+0"aG<\S0 $dsOMؼR*w_稥Nr;Y]cO{K¬\ YʯaT΢XSO/8JJ䏄w;<-!k_WdIO?"y\jO쩿? F'u?/4_^MYZ'Rnx*P%O5KcsԮfT.f#ITnK2TٷY}V1}` c=?}>Խ`mPt#Wl.2xԫsjy#k> $HgMc*=9\dN4ؽ ݉U+5"#k]\Dgd0i:|YYOB)T6ӎJ;H~:i {P>Mp1NҀi M4挜֎x@EeMf漉jv}+;K #!#vzS!P}h(J#hPvdb2 {m5-\@WF@R*49TworNĽ)F:j@f6,T ֌dP35LWd,>LP?ՆE\ɨ>Z~5͑@tvyAT4n!Ȳ=rўvFG%zrYtO%oEz:zQ\*?s+63UVT?3G}N>>+яtOƢwHbsfX4i[a}M gl~g4gGP:נ i]J$o/`3dҥ{4SSizd?vƟzb|Tzֳ3k|I3CJ"%fMcknQooOcն۵!N}#W>Kتg_έO*|c?{OVP<Ƨ-,3qp۟/Rx:F;}?Qש{sd*}̗Ȥ0\U[h~Ͻ?fm$*u(D h?8:n!%)8/xcMVAA:iZx$׮F*V:J"ٕAs32?@+W]کlg_G.f=MyuU Jщ׊UFt&gc\C\|ϴnv?A]'xQ&?*i#'jh2 OL_К֒&O)ۊmZf^{JTjǧF#M-mD1۸fڮ\G|#iEDΫ.p:b Hnd7V:ӖV;Z@u6JINHvG*ՕWf RShνk R|~UA<Չz>(Dc<oSPE-O4{p+hH@V?j\Ö:Ȟ6Z2~U* |>p{{ "c2>ܓ:9LјT*k,Ktlby2|a\}^m#yhRҡ̽~SҖ2EA);ntLA\.ڲyVB»xdD&7G_U9}?X22O\,u CQ,)uSDɧl~hU|V*{jQr8ե6S-ͤSܑAnMfTZs't- s`qP}Q#cwn r?Jם}*_˲՝e=RRGkb)cAR9GzwecL0+XKyMz ccaZH>!܊-bneN[tu9ʟU#r ÿ=i~>F*56ON)J. x|ҵVdmež68"@-ԭ 8m*zgLsNqHA88|NקJ= #4Ԓ}iTiqJ4)c(ژ!OQH|lqƥVsGj K}HdI!*8Uh E&e?i[MIF(6ȠzRXO7Q5Qk2s)8huemys UDAi|9_c!yvոpidYgb"5,)U֝y,ڣ=-Y91G0"*Nm6ol[mc#25[v[fWlz.,e>^+E@NpK ~W.Z#Ee%W5 XD9=+JMNkc$H ,1Dkcس!myzXF5?<3|+Y(i9ZҾKh-W8; 2ܿoBq9Y'8槒m*,cPX mZjwYdVbJ[KǷnz'"FrvSCI0ivVLN\,~LM~nZHSZ޸8:Djdǵ/lXr`mX+ |GlWPa{-TNX76{y*oͤ`xZ/Xkpr2LW΃VZLlb͏ub?q]A1Uuk_c-VMsBT䄡8.n?։Sڳt+Iy)J 7isLGjm vh=);R֚Z I敛bװU}y>^V[HީO}yI1ҍN->Ѥb 9]癥w9$T*9#YЊoENG9 yzu=DP YDEXe]T^ivIxRUfٷA+8G.a,iG1CR-i e>U*Yqޓj1VoGDV )Yc?NGU|:#es0?^զ4ݰv#r))EH˂UdE-KV]Y(UJ4N%ʌ:p%‘_XViXLg1e=8rF)PDN6h:r̓怭U?Sb~OǯnU!kG/\uFi geX2!fN޻GZw+]^,JT(®\ϖ#f|;u5WCͺr8QWWٜy.,ip>;TUV.gcUWjH)-?Z 1=ܳbMԅJЌSszߒ6Ϧ-5L,uév>Sknk[*B;W9j{|fҩdhRޓc$ot*ñj>\w(U w4DG QW`J c\;1C$GVMa{K7l4=R;v֧VUc!䞻N)}ڵ|A0ǚpj9a vZi3ד{ʫ7Ѽ]xfp)_F*eϢ_sK8!i*֮NV&y,ē]Ֆޝ:[۟IQYR' PZf 3W$xw퉉vVI7+~®?7R^›2I8:n{R]Fb' ?>vlBjfbLH𫚗`U …I)SVOy,h]A햆c յ*'NѾBޗh ='9[-PD?w/lE#a?( q9q&uB<4=]*8\S_򇏙V/#L#S/}j\"XFW_ N)pvlP-&d.63f4jiޯ5 JFTt+Bf\d5c~oh¯Jւ)F2֍9*Qx&3cWF:VDBJrhp2ThFfW_S)BQRz]8[3vԊ !yϥktu?5Vʐ4(?w&j-m-T<*}rڍѹfkҹ؏RwfXWx٤n۟9*ajJ.qcgN#+GUN+"jݨ*JSG.Q#˷ʾ>J:wF*JYJxJ1VWGb$qjOϭ`A[QzKOߺHkTtoYXYPm{_S&5aՍ8]n!\ǯkK~ rU57&?)e挜95_%Ҏ89pD?Jӳio=8og*gʞ&Tq0yLduS**#vFͪ]";rG )"ac)_i d3Va+|3hAZ` 2ˆalIfC V2JM7h SN1k㌔;ʜmZ-d+WClˑrPLMUšҲ/Econq"0]zޙ繷 $.~Cy9LP2W8}"MbuHG%; -"PبDh9McvQl7R%N?Z等GwwcV)yKS֬tϛ"1ĜƸKZe}Ǘ穫Ww[qi/ob\\Ox½PQ3}M9c=+ï^!Oj>#-[f_y2?¿¿AU_-'&F18Ü0\ÕZOyU^Fe^ShV!I8hPi_B9ɖ/-FֳX3n; VE1yD#)C/sT6t@2/CʦSV?Տ$yȮM6)@G 5?v<{[=ꀝr)qZ੆K z(3 4fͤH(.*\ ϔz5uX PQfRzӼ\fhLhY%hVCUq 4ǭTj$58✌*,њndUŻhmQ\qZk[啥UW\mOѷ`U3Fjya1Uuu{u *;҇$&F*,F*"]Ue4„jr:QyҤRSFU-c*2#( h ͣ; EQE(Er~Bv?Pq׿C^}]tZt{]>F?&#ʋ~k%˗RKwXVa~&x A׬ Teuԩ)}S]N'RfQʻwKhbKȷs5Vw\5QZ3ܷ׭5<:Jq,Uп) ޹~pQ;^-T%ঽGkT@)l{WWfh>i%O?. NN+V1M*x=)6u=iGqM2yQ(g:f1ڥ#91N }i РFyN g֑WkRsJ@ٻ9}j9$xfs<ɿ^>2xo׊ޝiB6HCݍ`xs4^X5cwKhؖe4m>}kWuB=H$zYGQAMZTTu+YCk78.zfgc=+sp\2pjEڃS!eUEFnw*(7(ݬ] 1|?Tr]GDSts[f`4߱El,է`џӏV.Fq8O$w▃H)zMEeg9(bIfU u!,H5t8&`1<6)'E,]rHBF== kɦvUM1c%9R)ʧp){hϭmk[M(SQ=3Ji7=)6<>PFj6IzQjE1FoIG֍@nUN zgVI@քnc=A4QV3ԙ+wrg\0x3N;W$*{BpyⲮ5;$*v|G"41ڣTEi{J1F8ooʄ5?ֹя&IhuP0󞎇z)?? 5Gh7)~#|QSnU?uҾ_hO*1æ}|^zW;̊G7퇼T>) 8a| zw{I+i6cM V]Z롶+t}_d*w4#׮Ib?./a?"NB=$\?U?#4iHH>gH<~ܥsrLqu m0M7sgLvVA)#^z~R{TؾHլtˮo]%ټ{Jjt5ڽ J+~2z'j E.U'#r^baۭqF&2\)\'h4TorjO\?٣!dbB0GnME*A̧J̹i6STcfhcbrMli1RG/pՄWQ;bls𝧟JbgF%,I'5xJĤ||ߟ[_bU&Z'?4ֽUnoV쩹2dy8DRRwk7;UҜ"G{˲|6zZ"[‘h|1*{ζ>QkR|gݜIJ:Fd^-*+("'F9y5nΝaȿSba ;vH35pld'ެjHCV:.$IZgR\|9˙,fasEq0y;I;CZ_;j.*\(\Iyzɭ+`P5f mZ}oxϰ( KҼۓ$~X<`{T4QE-9Q}ڑ 5iQaEjR{TNWp_j4FKjbUOOM(kFݴi N0/.*Eɧ*'֫3T!M9R?L5)vMX 6APz)QT 9<}vy$3̈b~tbA7";ԁMܝ7Σs\})nq|-ZnTv+Hn5<#5[hG_ғ?mi 9[9&?A1$ߚŏOFᬩDΆ+ia™-"gojbU܎"ͽ`fa CRWRB.ORZXɄ΄9$saJ>Fy5c1O1 w˴P`d s^iPrR}iUҿ-I֐+CW֣*nF:ސV0\⦍H8)`ZLGJd ;f}c"aivHQȥ8ӗB=_+XWѽIiѳ9OiO [+ږz)F4Jz Svn)gǵ1JW'4^ON)IOgirjsL*;sJsṭpV)0W'~(' hv)̂~T}jK]Q!kv'85J][sքdT =S^kυwJo^]_Kxuf$E>vx>*5h>ЊYxo!IFs֡kx&9JpcVnn4W  j΂CmQ2S}qֲ[WmuysuWu8_TLai3,@Mh^ez'v 6ҦO*U=eB>cׂ+n;-ψ$,4MҭuUC!드UHC{/Yؤn/zyeFvϨT2vKQlA鴌V<|iVSpTpqN7/#j;]Ov*:- dH(i}j΋f_rm8?SRF?ppEy(㱅F)kzKs]/Z2>9?P-wko:OJ-.iJ@U4)qUfQ;]:\KGzMjcݣW^;I5rA6'kW#+Ma[ s xԩѝ\nϧ?λס)Tw6FEe#kGjgnj |rCV[X r٣(<=?)cJT-uCժvq+2I*&H6pukJMzʿκ<'7yRiII$hPc4.8P=*VbiȄ7 c[M;D?ZֶҢww֜iIPvWWRzEuSA'_aJrs}SJ GFxu=z }MYA|~QA\KMF(ipBg,upBUvi6mn"'֧8V$()HU,ͱRM$ >dtVY/Kt ~#ҝK>H+rgQv!;TRΐDdE%jB _N~R~DgӭޠY-8M;+˷ )S.1/FQT(8Tp%Z"r֣צã4ztNKo0:B¿׏]qFUxd^Li֣R11ٰ®P6OQ]?Kί4VxhR^j븉VX^NTC+lqԅPQKsUtYJ.m29u;^Nñ~fY}16֙1I4IC\]Rۧ˒0vi6OXJBqU zөOO1ܻs6j/4G![@09 *Ku8ӎJ:U8)J_fdy4Wy?Zɑdu FXM zR*:*iSSKڋYVR5,~ϵ:D%5b }ͺR{T7fY`K_?*’o]Ju 7UU-g3UM\]Gɋ>jdo Hv1}-Ԙd}_X$VJRڑ摥۩TW+Dܞ[ϛQmt^i.&yr9&c"䮟NO 88kdW9J%)M8׹/ CN/6_C*uFv1ɸhbkUL:IJ0%}qʷ'7DHkjwp2)ޫҩ]CUBm[tG2'+s[MZcx9SV[gpsjx爠|Bi1d9R;pGYQc*]RPn=i yryaor݊Z9&Q->ޕt?!EK9eRczqM}%[ʙcAg񫱭HdPۘm4,Jєh[,_:{ 9Fݿ裇؉>(.2KZQ[eW^,ҽI:/WҺ-ҝp!X!LI5#YמkQJƽ*k.w=f$:LBSu5ۧ"v-U/*HX>%-S !,ԣ7)I8̩20d%Y{ߵi7#UT~ksDBWO GzpQQ^mO"2]/5Px;WC!1ңR'0PKB3@)I# )S t/HpI.zrGzzi]z?Z6}W' ib7st \*ϙ*VR#֗qTו>zRp<җ$1h$`Gz,I=BJ q8`(4UUMJ&m~3Lp5n¡{~VRc*_I޴.[عo !Z|땶oڛ_ h{Scnr*,ڱC2m&G1M@/έ-pP>m%/Jd%/9ⱌgJJG-JNܭ(LyHW]oN <!ѷjϝhxzU*[0lſ+ެ<;RIjIDr6p]IUZs<kaLʳq%Ʌ'A<Ҿ ^sjǒ}6ϕX-' *t;E?tgܑC 9mcqOiG8#89JЯZ^`'hVx2xNE!f`SV;I# ɠu*E(2JzUVIA sOq1tFz-̩Ujr_DT{Sg%b8j][>d +@#SKt6sLʎS&4^pT&7Q\ᝉCNvuKwiִ<9t"WO ?5HM7cЛm *CޥKrđNkIyKA;EK$|{WEJgKTl-Mf0󚴩M;::e]~H] <[ԕ91iG/8^Br(LwqZ+ m⍹@84 A@4tiO4Q13F^Ҁ8=EB`Yr+#V&d6Y;%m>d޵SS6URFLEv"}L7T8lkc` dn$|FjDiz3ޓhlrєsFSNAJN` EqN>3AqG~)zHŒ/sFy+AG. ޞO:7ӥL%uaI6L|:ǞsU )&3^#Chx+== joe^}ſ$JyEFU%,~J[:VjSs(5[Dt.5c%L (2m4rڿ-sf1V*/h8f<ćh0G*N a.rW{A;zbE*|5hI+<ܧe5iqmSⱼCCXr4&R8<ԾjvuwYs|[kS+mLp+>|XU^M S7|_֙4Ȋ0ܓcӌg^Muc59R㚌"j'5I3M!^5k :'c3dq װ xAOJ6S&zֵ{>q֮݇Ew2ȠUF jsWOq׭ۃoi# jM`"{9?u%1gJ4>i =kRʧ(tVyV?.q\ ͨGf8#qygH{u屎 Ej ߹z;HeW$`z׹N(#Ni)Kdv> a`yo˧/x1=})G[q7d%ͽα-"K2sSZpuN#li{xT}N)݉_羑 vX dg=G51D-Dž+Kqټ\5*/s~Q2$9/%P]sO95vU_kR8W,џ)3:Ƈ[+>MFL`OycBYؖ$ܚDd䌞)QRaW֕LD:Qu vUOgSR*[SB4Fō NTj\niDtvߊ7V/c7}&v쨨K9Y4RP5K?JucܗR=|J7[aVsMi#΢j$^{GQ. ܊y",ǩ:">Tm=jid^JcI+77ՙmɌ+0ߥ2XܓFTm!5ifp:N7V\CM՗,ɢ uyxqڦmZ63W# w4+Uv?eHۥOC%3@bѫ.=u[׹_|LQNq;bVz/쒠Bi^%oN =أr9N؃E*I9OoqE\A"T cHO*ϱS[mN}Dlv/T{9FT4JMddy_Jptٸރ xe]ĝQY"wXuq aTu)"u 2H"/qM4=(U zR۫$J6"=jkmrT"*r GQҡkƙ,M.Y̾lܗRN*:P?:yA8yP)6dSq֙ڕW4X\6PiqH8QH"N:QEC{T|XTWCv<2~8qt$[ \ZdEz3ָ?iiz/ܖFcf+Wdhkɕ6*P9*Gb? SPȧ"j6alD)EA*%kDSYZ%>0=n&ryGd{_q;D-<۔}oRrCTRBt+kTZr%1rKW ێ* "ݮ%,9T*jӓY|9I:ң!R/6CO WZݏ'*Q QX]Lmqe#4/jm'tWg\\^(8mg_JkB-jIܿשJ c&>\:e-?o= 䞦)UvkQE$yWnDreV*9S%jݼ{RBZ1VTd+):S.0:_[;׵%q3IV.TUF9`O~SS.;;36&uֱҥ$?$SMqz>6#E'xjI4qǒ[}j"''[*$ eTqZ r8ڪJRdꚄHs"юk{A!Zp9e6@6kŨޝ1I qeZgq"gz|}7c)bBiw/R#oR+Te8'?>JkWajN$VQ5)FYg䣟OkR 95&쟻Y\6y~J'3'U8ELoMs:=I_yuKgҦT! Yt4^4NW'5h~Zs-`P4@[!Q8U\SN1TٻcT.whQ*ϒ:ou' D'|}{Nf\5ETK[{(օgw{ZK_F?o]jFvKh8UT`(RЫC׊dleEPy{Rt֞侥%Wy⳵}]l$emƝeݝ9@ɍ4p)am˒:[׭Jkqj[bQ-7$/Z$6c7ޱ6j*?+7F9Գ+)'Ijt{ňr9آ-n2_^Zd#@ݦj2'Ҹ/6Hti(dϝŻԲٟt_u\yh%N)nPʋi#Ӡ$(+?NOGE҉Qٶq;נott FK2=z#Ǔ#gr$=JNTS=~m\s9ԅ8l8Y1dSu /w<۰rͻ'19faR 6/*HSSX<ŧ aGw.…eEK ϓS.J[?ۓO˩x|da=)p:y15*{c9X7.- 2J/Gz1xw_䵃s,rnei\*/'\KKwzcy)YD&F!=MYnKixT^5w>X&,~Ikv *Mq&ڧ_֡1AFqBzq)QL(G+]\|JC=vק׍ :U <=|Z$o7c\Ogpm+Њ=~d뙣yyR퇖̏ӸiYwS-(pI:l,sLy_cUmź7'4 vX.N0kQov,淥[BeW]*Ds1[VxUQ\VrE#JYdw\, /:U}.1o#RL} VmdFIO&We%TvVs{ڲf?tp)N걩9t!MsU-:1+)+min_>DU MJEL"Ʋen!UUC"yYf;V4ҭn9KGZ߷5Ž vqF5kYʧ6ʢ?inbHbX\*ĬSdn@Jӥ o2.Zvg\N+HӍZqu[v}̽ܖ?։ls\ CzԒHĪwJ4KhT< O4w(5Ww-t# +y<5"[Nܤ2w6I+ZgL4ߴ< I]PhGv wm ݷH B:4$kZ _ZPShX*4ŝtzNM'o/>?J γzn`G!O=?+U,G$FiJ1;*R bUCFqu߻s|":5(WɌq{Vt`#~8Ɵ "f6fV5M#M)fU9gmVkxVt+bd=9z寗@^vk:+i/,ΣQq *Khݕۏ_Y/Y# {618 #2vOzﴆ`L3&64QI^f``x9KN)J4<)斀Ɠc4,i;ojaړnG*sR,ScPh+仏ωC ^u95CP'wdtE zxGJN-Zfnj8NY U7||}of,+?'5nd]}T3y$b$6KKL1ϧ}6~V[R4M^3J*|Ӈ~c'1 c,p֘3g[ޡbk8 {*qV[XL2{U{h?  <OM:65,{ӡt2v?hY[0i鶔.uQO,FSn#޹ہp"[qZI'F,8TĜv'ڴw:.no9.y4 &9A1BmIcnR1i OT}o;;S:+ &2:n)R 6B=*s>٪~%25dFWT7C_ֺ0@P"lko?qoeGe}hYg}ZW$ȦBV>=ywۊu.<~o]ʤV'\I6ዲbOn{dMSgdHGSB+K:{QNRgLpK7)Oғ< 2{=(OL=)O]@O,`ϧJ"3^Z+>3RddD/uON+L.E\Gt*Ms?j,e89w+f,Rzxqhؽ"4BԄ& P'\~"^(jv8)}EqK8IHOjE&3MJ͒Ƴu-=iNi+'_b5溻H#TsӵS[1|jS.?ݮ:y9uZG2'CGڊ:Ҟ^M?Oe8(fˏ6@P3YsYzh],yΛ;P3QTyQH^d)@>5iKN<(Q'i jt9eZT=L>&*qn R$ԉ!| p#b2Z3["mqS:$-lh! xkMxV[)W%C)Oz[:Hzj֦̑ 7j͌nٸc4LI1~qy(3^Ӟ'=;UL޴]eb-qU2VSLEDO&ɨĉ[[_W~UJ;olTVWwT֫ua+($UNK*(x̪X*,욍丸w;- nsS)Tk;ݘrGyd胅E֞pi*^3M3PB` \wQZ2ZO35.!BIJ*rxU>c<;bRzԾ`u֑!R3pdӱ~4mGQ12QK+Ǩ4.^ߝzUrŨis Fi(LiJ2(Tj&rl(:LAT$"*ptERK EHZSs4 /QN3IU.l jd. S/4bː taޣ tG>ݲ?P+1YqF*^ _/-'̣8旁FIލPj0?4烊Z)9RƗ08?9[Җ3KTPQ]Ы pچ _qCuk  6 dv>ƨ'BZڤdWMrB_-L$$VŽQ'0W3yaqhg'k;TW\b$3$W:}*RzwX]ͳ.T\t<-hkcelyIZ슗7[&9Fm4/G"eșd¿.*'sWYK畭y%xW(rZQt=ZSxVE+H⠾]yz53n-  "u/*yZ*EةV5Qk&x;?uNrzUl'Q +U8xQIen 1(Ǿ* mnNL@rO GR#tS?*Xc'ni]5XxDjI*} URICdW ɏ?+[c>B.5f8,qZy5 |Cp(+1iE3*L(cp ,gzVZ`N&oFQE\%ϑf8UU~*T߲o[eN{ cx=6wY WFi.Eګy%H#+еXoWlNSHriݱK+E4BE&ov=&vj${[;ELj@ KQխYb1KiO #Wj$̰/KZ!BoIX+z1vUnK ..cw9?ȬK/nmG{U*HV+om()~v>ҝB<$Ĥ7N~q|Jȫ:y~*?|OnEsC s}OV "FLUUԢ^$XSwo66JeFދ?X#ҚG5Lufc4CQ\vꇨ ÍE'%"M*Am5oٯ&=ߕkŦNT|7Q"{R283ֵj3[ubW^8 P27Z> i;޹txMʛ扙u/TuR6[sF خ `/LrznZ], 'kfk8e}٨5T-MV6ĝ*.|hF(.՛+2| fmkZE ?ձ0ؐ/es$䟻ǃuƣyolŽ֚@&{G+QWu]G:[3Y@XY$ogukJ oO5l v9SVcFO).RcK$% ҜE$Co茈Zf>>Xi*roGR94/bFՈ wI7(a(mUDmJU*I \]&m=oH6FGzʮ%ݤ)mrnnJFZF#\)kVio17?CZʵWib~w XR1' :^zy8Q 9*mD;T?ZVPx_ʤ'8zRco|LZLc+sX[;c\`(;nc Cқ*<1*<.z֋MJN}k*s<'4S)S.N•g\(AҝF=:P+0U(?vRgҗ5||ET% 'N9"Lq[PJ4NJTݘUk-S'je\֜jXUlP^O:O}QQEu=o$TֶỻI4~D#Sӌ*ŭvǽ,I(R:]tҥozNGޖcgꍵ$o,u%-D>|5vāUbǰ*~S5Ps+1f8<W"FArI96p̊X VGҍS %MMu#;FwFzgld/q+|ZۚyVYv:qMilU#Lc L``d Cv{֕$XJwXW6*.r\X<.JIgr^~rvjPh̿/0 e>\D?{_Ӕ gos>̬bL׻C(q*Pݖ?}U*%Yv)rj3 4֗(zyEio(ޏMCNq3ٗ$~u)a曜v'5 ?jr:GyOG6I‚~*Z\?݁tT/˵G< E7(=J.{"'tC'GtdhW?1SLn=*hqt_THUM4 KѸԱljX mHk :ఐB?e.nFajXUwւi$,li1ȅzӋ7$riT:E``ذ"8G8ɨ}*H9iW4u8)F Siw!^J -Y‰;3ǽg`+LAw-_N-B@+׋v9㊋--םo,mY)_M"?*h)2{V^(PF]N3R 3p특6v6v=)h(\Sdv ,Os@p$b(yGK ,ȱ W)hS+gJ2zWڃPMW`y)ӯ!͙ g\Ic>X t'"V_OZoFj[Ij6xm0g ר5gOcn[G7a.Z﬷1c[6v͡Dѷ 4E!MV14RPT hڹy$4*w:*Q"HiUK  K6ٯ]DcTl"R-X[*pjJ,(kІR4ugg.f.j3yv;5 @+yWom K'|YjF198mvqX?`a/fԏXNV,#r>:)7ԾnF8ZkkEKrnEZe]5戺d].~u|ru]Yd*#m۶s[3xJE62F|qMg464zrz7:7?*BsM?ZWiNSThL\E8O %}8iHsMCӖNiʺ'*7BNef9^"H"i\"Z gY/"r:u*y9%~]/\Ez-H'뷚ry h=M^ H1O+Ώ|)Fښt=R&{ez*,O_+.|ټ9U<֕/k>NJ7Vj:Py&>{\YݞBNkҦ[<\2xfux*r>{\^\}L ֻּ?]oݏ16@d(8{lhzE4!c1P(taKG n29RLCLqTg5AZ큞*I)WjPz~ݥ\TE&=cIFp}ӥ ..}(&SXS֒- 4!qBR7jLmx+[3o}jӊܿȡ n.f3sR^cWAKJ1J^ԇ4Fh)W vH)"!r'Ҟ:P1n)Icܹ\o^TyK9`zb:F*G$d6cv5 #ڰ|KճUҹ<F>F*ȧ^d9fY]mo*$uZsv \$T ~Ti:oXAm ZP[ ,qƻTzTqKF??*‡Rn)l>dR= ͥͲW)5J]&AVjƌʬm3q޹krX:5>ɇs2qVKsd~ hK{EiRp8ߛxS׵ae""܇H`pFwu"O͟J֌M:W 5*jnRÿ9Ocuoy`umUz۽fyR449+#I3_Zek {NX5f|d!GrzX5(XMγ4=㝼U۽B21v WVfs移В5dCО_kVbԡR6~Hpy_(5G0 }neTTBUUp>fXDI7?ZvHdhW\x-yáS=q޴G NXө)YԨ7_pMj #X䁜dsִ9ݵK`jܜu]m;q,$FF f򳯮R[X/YGQtGB]"6fOSa+=N)+V<XHXхrVfq[h-[ը=>AohWUX? Ӽ>ih?=WϷeܑ kʩ,$uuG?(ֹOq'jDn'լŸX>zȯ2MF?y:$5x\ xT^XU]|ݿ?k.]c?T)T5q4X/u=Mr1ſ奈?֫1x;OVߗ&f@̌T?ҤKFl?/c#ZH~+M91xJv)_*2H4=qX¤\_eV`:P)ǸNFr~E{ޞU(8ڃN˜~FP8?.*CxExU +{K}hTݲ0ϻg?2`]R\ASnK?WUE#r){XktH2i~p&zX%m||j9P+ϬTUPxwcviwAϥuH95K̒_R/BG$1ƄǵLT=GzXz*ԋ-Gʵ)IEJByFT$Kw{Ucpj]\_neDpöR2Ǔ\{G]Q_ܜҰ9WqxV~%X{H.8%$zzV|˲V\cOfe!Y[^b@rvJF)JM/ טKXâ)C7R;(uNH JZ›e `zOjlqzUXN1ҬE2*ZOOj'te8z(PCz4LgȍI)w tҝt:E*}rܣmnMUrӴ=jMUrGQҨ50&jԷ?ҥQh.)w/tމ68yRKLqj+rsYU,LS֨ףFg 5(;?آ*ṗ$}jIM#CQE%h%+'ol*'vJsQqiA==j*UBJԜZCCz[]qTSNfE\bTVݞk,[+.;kd8[\0F^ֹʣw7*C{%iIMêXwk!;OںXe(ܐ kfMzʧ~\RqMM.ٮ~RuP@5,L;ڢ;0vӕJ%t4r*k g]Fᚣ>ݱEyWmsmsjxs5`@*@1Imi9E>ΧccoZ$ 3M&ש{Iܦ:aqLb⑏jp9O[X\ֹ.7WY zW&"WQڂ.UFsz[[('?ιmϿBGEvk qI b'eۡXцPylr@V6V=hx|k[Y]icuzQ6H<"<\Rd8ԝMv+YR\f%P~¡=BIWֳ.<Fb_ޯiS$>Q?Zҷt/T ɪ1xNYQ?FpqMJȡP>r?)FYؤ< ? (۞YpJnN:vH@+IESbz@?ZRvGlEu@ u'qޔr~QEivUXa(jBԂ8SM@EbШXUnsNmZME9VZ77RM]:&@ ;y5*@'8ո,wX]~V(GXV펜q`ݧۤkcn. u51~O'ձNr̪=[vqiusJ)mBSmonyK.FVw{pNFAL֗j,\[>%mq^]p\2dmvOg""+RCWcޱ͔SYc3j$ =)Ji䂅6z WmëZHnY&qW ΄zY9=M0}i6i!~gojnqYN23,'p[ƣiX=ZFڢ2ZO1kR(T÷a,yڥKTcvic<:[Ǡh6d$LcfAҶk#&7Ѷo^:㚡e#nIO78r*y?xM[YTHw}}+(cJŰHUn17vNW򫺔j{529PkI /m+EW HEq3kKTHXNf^FOO#=3YF?ޫuvhV<',X|4O9N+mBruT[c_Һ_'`ߺ ޹ zVc_V7JOhy)XzW:OR" qM#4|iG4+h^cdӆu?rWjsNGVK>eg|/{iq>J2/sұχg%R}/@ظ_NwDF+-Nj q+I74yGFt 9.Z&sivZLmeTxC/OD2C&_YG ݯO%mRV?ܙ V0~U5"zz?n:p8h;iR=ҜjʰKE(4`/Ҏ@8)A )hM iݽ3L8FMe5܍p9Zrb@03~SrdzSү)2`ڗL^8 ]ø)n\t  b? r{U3-'c'?Ht)OZchczҦ: w%V7֣lc󦉘6I!.";Nx5B `Gʭⷡl#NQu9xIlۜZ 19-PO?ZEI*:UwڔiRR)8m"ji qRFs95h#6[5kPJrtk0_j4agsFUTpkP=>#mt )x8423K6#cyGh۞E3͌ue.78.s~fdqQ6/K;q?Jǹƴ.eYj"I!fowSHԄ`՗&m\Vyfo^[\ěU_+.\IxoGE):\TME-EyPSةw+R1}~΋搳rNYE: ЬYF;[#O\Ui cd5K=@>5WƎ oer.on=_uo\ˑJ~ϧf$cY| Y}^~Hk?/ַശQ:'8OKSFxfױG Fl{ph&emp3z}ՆlQk諊fqSX5Qm`>GZjXn'U!LEu0ǚG9bn;nfgk`GM S(GH?NXc S d=Aoldg/ jt&,+FѷE_ YYzZ͓PtfUy%&XjΓF*9c \ݲͷItX=#^Hi'-m4,s.#CyFt _/f~1H>bo=1JuK-stVr R`Рp:*aA*U!EE]m"3͏A%C2[ʃԡt'4X3&CEP;>&XVleJ韥oʳMaUE:4icAcGGޚUpēOތ{J/HcOXb?Wbk/}=>퍰KRd?/W.TuVՊoT 8hbOz_h_QWIL}+sDciE kMSia?v4a<4`a<:gQ]>mHt_k*VvBҮW#sY܏eWFc2e_z^'ݝI8ʀ?\iN? f~#]V#u8''awZPMN墟 uk񨍼_ji;9E*O4S1WOz ?ڍ?¬GM>ۿo..i iJSjzj> 5gz?A-WG~E,Ex?\8[+5b?0vLɔ~}j&nO)"]NvT5T2)HXTqV;hg`~O1xIgf[SϜ!RT$ޔr>s+H:tIKSU5]:wTvT8ɯ-G:yݟ)z&4֟^[b4j(7xљ6)o9E)sQH@iR*f$Z2RL9GXr3M}HKrg;7#RyP#ǹNsƳR0 WKy w^{Ukm}cq:[Gz檵([,zt' 3w΄&#ѭ)'W4i=W;cç\_o'`VцXf;"Om,)P?SXo"H>ЛzqřNcژG*1y[O 浞+4N2j-Qb̹Dd [ڠHYE ^vk=+Pئ~⑬02 PmHw{?g É$4O\upL+J)Vd G?Q0byQT2pj\Nu5<ˀJ3}{-c(g-*G^))|0Νmg ۈ(Rpr+z"4<6ܟ.ŮN<{#SA`'7i~NsG\tԢi0](jMe`Kdmvղ3ӵUo!<]-(:u/C戤pTcI >]˷r T|.E:ZF|<\ns%kK B}yOh=N"b}zj>;g=xR;5YJHs:VtO˦9"=򮣭`ͥӒ:o p) SmYywZ}Q]lͦSYwTt|Iǘ v=Z8rK'ޙ+_jdR޹];=IP&(U_U]@]ޢbbͳL})VK6e c$°Γt?}:;ڭCK=7kHZ}p.P`8V)[ݴ8]8bN1Ч+E$lm{ޠS~$ M8`w?ͱUm1GDlVuz#s#4 HƍY*)CۥKQι>' rcV*#"8 9.^5@ҫWyԓWu'h|z d&ZAz+팒uRTJӦKk4ici BU5WIf,ʊ[kDV15/\Nٻhۧ$^ՆFӃ]vP2x_ҪxH9[e*^Ud ?-UsRs\n,9ةT!.d.LEJؚi4o^ Lb$eARA(|rE9YcH*XI((Pr)E4Z$ꨤpu5$a{ V|gwNKm[,gڢ14eWt!*psУ\%u ($i vڙ>)@ZdtI1z~TFī خs֫1S{QUj+\:ͨ޹XZSi[F7߸qX5G$ZO>tH٢F֤oZaM|$'S$ܟNq\Fu7p|7=kO^j ڹhݜ68*A2{SdO\%E 0E Γ"GtEtʯ*)n_Jlvtr?2;?I*2pM{4gEƣD[p0“nNй&uwGFxM-$ - {sZv-@oݪRB^Ev=aŸᩭ*~ΜtiZst㠰cWi>463LZk6Yb9U#nii bNV>=9jz) 0sKF4cB4lBH2L)Jű7SS~YM(PJMֆ`n&Y$_ܡvm! V*a*08lN.4|V.0"At4T5qy(ds4$ކU=+&Y$uk[Q!?`Jϰ{ ګ{ZdKcg^qĩqz?hp>VFSN N_qf!򶣶SҨϣܡª[S8]_-jq8[_+jMQXʔ$oðmIjlUb^MqU=o&doLZ|*ռ1<̿4Y$|Ԕ Semz霔#vvT&!G)4)PzPƟ+?vt'~v\O2|9>ՊscP Ԋ<ӥ=JXΦYvڰKLTTްb'leRW[Jx-ޛK?:{j7 =ɦI?jj:y#ϖO~Vulz\/ ?*zar))ԯ}'F_Wh]7SoȖvb;+j8YE 5~tCI >oF~v﨣ײdQ<~ǵ[q)v*ZhJP1K@2[cWj&{)M%8!=)6U9t1jnr<.NRuvK\L7JЇxͩ8QNUzƮnsOUMw bꎓ@Pq֋9ȕYsWm-Y+Ly5\IM!:&sz5g.A5ݝv(ZȽfb]; I_"ɩLzL,HTg O%1P I!z&C8Ɠ4*R^r%I(*<џZp)Az4r%*M,WRUwS2B*S)I ᑑu5.ӷ8 #sSެ7 s˵F?Ior"R5i [OBXyY?K\ iRET&āڦb&wlY>R)TޛzUMFwoqI,rzv$K`*>Tkܤz2հQ/XI,kNS:R#џΚ9p8I'^*PӶ))F1ւ8!;Zsj6xs; jzLCtY^"$Y*T&"O8[E_''WE7c,Fz3\eu0u$iwWj[XLuknoJDz;fu=8?rOָ߽hcϜEM]l}T* cNtac3˳+K\ϓy%$Ͻ<;M9uEgG]u~ѶdGbfe5{T&cI'l'?RAb#_"<;=̅| fFAϝ@ evµGkTę?w!nQ`ih44hȠў)(n2oۡ8̚=iqUl~TS]W,NXaw)Ae5۫ޠVnQis\r;]ʼn7LVC k s;c֫ f+R>dW)\⣝,n'-؍sM1I\O'G;b55rjpSEYu_ky=<5((WYfp\`tƃ)0;GX'W]~EӭT%Q3]&X\&o mUqj: ByR67ON&?*\Hsӽ LJJSiʠ(x4SԭC%_fG>aYe-fs#cv yݶ1]6.=dGGpG2=#x"jŭ1={WIcZ̃aDDEڊ=3/v~lOHaRduҒ&f eJs\ngWjy<5'en[k{\hRz 60Rw+E!jh\xɌ׈b|"ސIyY(.<|.:Ok\Z#+ɱsA!NItW3CKSMn e/R1c.8Wl/I"]?3±2#o\g5^ڸ:}n_v֠)fV7Tn`2uFK*fsZ]6QFG["9iN +ZWb7? B?m,ȥqF ]L,о6&j"au6z'މ{zj{hyҕ Ӫm3GdmaTfҬ8 P*VVg9.ǫcE% $g'޺+C+\ַV7kN69aВtՑ6IcLݴⷴdH mB7)QǷa^c2"W֭( H"zQҕ4{ q# 94HlI*b8rhMzv?N9(q'c5Zحo'kX/%OCĿboRMt̉B0T+Fy yRn23'66 ߍr3iBH|oB+Χ kX{l49fqّE-4M/KBQEQ76;݅.M%'i ֘O4և&L3ES>%65ڞ)bQEsO/V?=MW4L>k IT \%˞[Z<Ϟ[t^yPtCO?V>`vv?3u{unuЍ/HR5T%F1M:;w)=Aim;9#9״OY6w qWwmMU $ U*v¬c*JSQ@G҃Lv.\;թeW>\95Mv͈3q+-^ٗ~EXYvH8+y1]L_-/lRwc'۽H2v"j-䙣eؤiRjKu'ݫCj8ZTE`20b5}[V4{L_2d# yAXEjӸ9ϵk*듞qHʀsӔ/Cdt} !}oΣʮKhd*rZuMde,9GP^_b2x4-X׸5A7T`j[Gq!+TJNJ56zRO΄_xʲD qQZ}ѴjF~ְJ*}j=?{'Z铖ecKmudc~$қIUG_ V[76D5)ڤ#r,eU1zaa[yzWm GޫӅ8ǞoկhrVk[yޤ%!KUoNFҁLZ|q8J WڦA^kЕU,t(ӷ.ТO_ݪhj.5[]n7!BrP\O;n SU6JAZӸ"( wX8*Sq*49VKڤb$:\v4I(t95B7T[z*61YBZk JSBJqCV4CN[p}]{KE;Hp_¹Sȓ JPKd=5y,睾Z]$0ڮ~ק zʴDI%hD!suи[pԡn1(z<)*vW.v~cHeF}I8籦 &'o`OJ:Zs[b&)6(I,EV]UU5Gc' j/ >;:EWY|'u`ˑZBjFfZZΎwEF@&"CiiAR4UIxrHPɍf=b~>wT*ٮl>eOvQ^C]~qM)▶L$PfJmNUvT5ãB[B"pz p8cY>\Ļw/p{F''jbqu*S]02L`NO1HN9kC=9N1 S86_EM^:9Bhz # >?(a!w11tvwvGLZ]Z0wu;\ DexXBpp'$8<&N=ɮs45ӣQU7j3#|)NxհFyk濼9#/ ț#j 'cOB*UOy$weH"dH1Ĝ{-."yp}E [UvU[NJJa5Pb'R sCOLf2$ѼXi>Vo x^U 7M"90oʬ$SUm3WIm.kA+&5*ê 32iI)*RMg\A% ,RspGҘA٧@%N=.1i E\)]omWs/"/)?J "Hr=+BPG^ I4;9Ua_(G^{b˖G".YD/>#3LHco9j?CF;ڲ|JXbmb|ջ;WhSsvPބ]QJSz`HLG#8q2#Δo͔gś(8ێzZv-=LΜcǥd]jYbP|օ[\$ I bJ$m|Nkei!Jg|6>Z:Ryjz[a摤YYn(]MEf"հQR4xɦ۞M$$)C95=})k$z)7D{k-MxLl mՊFN$y^zUXY5:F~JdQ{sOfTRBMbGuq. PXsUWzEϛ9\YMTY_ҷgSW+qrGc2۲ɽq纰. #jȿv/|SWn ̵Y; qH~)MA$f4I"eY7Vd.Vz.*c" ]kʑ*8= RVOtnzHEt~uCh7qkъsKCYg Z穆;ܘ zAmzXTΟ ֖9 |c'(MxNo'e xTM^SвTaI$J|rXx{1Y2;zԱ _~+bKM2ztړ_S֩$cKQK=Y4p1fs{rjs3>b ;|}XAS*7ڐĒOS[ZDF;0zkr=QH>^1RQxJD^^I|OSZQ,V!mW;YF;իإZr Oݫ9zb-e\6~ v^}ڱRnQ4:WYS֬.{?jVSo {}k 4<+Vo \ԗrn|*tC5}xgVK_.>44թRʏfQ*+;.z>\uvdғhCM`N=8U%tǙrc/^uYr*Ò$!_ڡe*4欔RMDTZct_Lhkr0"ҷdrAA˛y-9lpЕp}iy愐xwt8eډtۊ,nOғqO: U>*M?Q.TJ԰dGqӦ_~>Nzup0<"GMCB9}o XsĚ҆n*Yzʎ&THV01,qq晊r#3I=ݎ-c,kr QS_=MwTh7?v:vsKN6)>vMl3Ŵ0U=2Hf]'N{ԷpE(@Cҭ[_Umfh.ysQl͵p ƝHQPƶ@ο/z\Xjv=9x:{&V-d^n]/2T%Z#&yo2yI~(c9=:UMJvdɰwxF} X(7Qs=*?;޻*N1vsf2 omM+L+8\l S!U\u#jӸK-UOaXEjfD0KJsi2'\Uj:tu؏i<'oaFkxU {U٬" sZ=OKH7G*?nq]s\ޓevf]ĎFI@}ynӎi?Jَ?jh<4 0aEW!"~5)d D[N.Q剝T6tX,?)2*~\X. w2?ZVZDcm*};u;ܼr @"4FTeƜc-:E$=2?Ʒ+Ln"=Y#׮z~=)I'Qǥuh^3J9'(OJL⒍P/NnugoH c'zӏ!I\7?!Xj/xjkl49i߾y B?פ5`*{|ۙd~f9B1j׭jh'$(ѓ D)6!DʣIA]Q%W3]f&miRdh(Wcut\c'*(jZQyf'U5ɻɀ4=~IhWr(đ"rq;V1RHi=WҕH9P ?_ʝ'ǭcUiەyԛJ*xYge=[ PĹ-AFN܁3SI>z2%;s{Eng7 8O7 ZV$Iq!S4w0lwO9.#֝f,frXiokm&C:$U%Q*ub@*jL 4g֔UXv-4+ޡ]rZsNSKi4dzuiS¥j4)$L8?5M"dW}f<ʓOҀM ޜZ? rK5v<+ Gf xyUOfCsBCi#JwXkBOJωn݆o߷DDڈyGZԂL{)XBیS2p3*>EsCPK*͝JI94/CАGO縵Hc W<ꢕ_#mL4rsVtEE p֊7/g-_.T4|$5U.NB}kjNkj ?.ޮO8rjs298J8IqWi^}zp:hUo-\Ʀ$*Oz tL~9SZ\2 #\fq%XDO]Ws]8;uSFW~r*吼͒3Vԫ΅VVV6}QeܜzY'BX AoVlaMSCBTf8N]V6EQ8oJ84&ԬC3K x j e3g)@Pi Sޑsǭ}| (^R!jḋ8Z8UU/BymEP$RU}(RBqSu2M*kIO19f' t*Ջ52OJaUڱӯ.Y>TXWN2=>kOSƻITIıڤT?늙xT{sαy:? u%?-OdTZMvMG'ɒX %!4Ob5/\ L%zS ZrVO3E 9ST'm-75šH?Mk**E)Rk)Shp$ ڮ[3WM*nnM:Nl)QQ,NTE$idm"V_o;?#z`cOU\** +ӣzqE&;Γ1YR9LYbebN~Z㷆#"6D GaSF٥.AutR˹8rgYiy2wݞ~m,O|T0ivL%8#-WEE!",J)*xTs2VNKtQZHP~GҴ+ G-yB$$v~T\b%8,^n$7HGoZ0Yә}⵷,t8>fۅT|Vj˾5UQǵId;eq>HƷ4R5d(WtXR#Ӛuɯ!c{֟x^VkU"WJ%XQ̙]HމsVWMS"OsҤ0IOxY.bMd Y;5y(օl"/>--a^kb?ydzT|+E&QEs?F*+_yRI$N:xU*QqǯJBUz+}qTm6'4=j 5jZĸtzp8=QI5+pجNfң |`0xUˋ&δ+62aNhhʃQvf»Edzbxg:Ϋl{KG*~3V9 u6܊}E:ݦ[r? *KBo2Jڲ6Zb}J"fҳby^-O[u<˂8?Z$^ }CLGT%pqr!ܞ JS갥@ yN'taRWԷu"N>Ue9Me F#)p3ڷT$hR-mݭhʺʯTj9R9k #";FڧbZ**DsSY\6FV)VW0Ues"w{v{izo-㴹Ň m'U++1RGrJMCsk5)(Զi!ݴ(^HQA$E9Rn޻H/0(UqV6/gR;ycm?\ųhMu:8SB:J[|X2H*( 9P9EL[\mEhv˰5S>S.}&c˜_FjPckQ0F&ܜUgB^1w27X\)cIۘYz^Fg$R}r{S,$Xn~_mY d_՜ nPsV$q(*Wujl8qIVtr|3qNU?T+s{Okcb5i;g js7:(AF15^1赣,JB[*tfۼƱ fG$AquۓrMek22]fr}+JxxsZXXGYjm<65BVb-ԩPp[}iבCeػzIJM%t%c1Bd.9h#NisQl'')sӵF%-bN`N)]~\R/QGnzQJh^6BTSҎ4趗*S=jR!'OVhr)u_Oc.2T!eU{oF2F&rAީ\؉XEc[Q i=&_QSCHACqnܧ8(6Y$$*M1Ȑ /Uִ6_H1#pƖHTnfU\{'^H=օa:rcm9)MabcB@>Xdvlՙ>co]U T@* UUZHUXa+qn6$0; ohvZ4"D)$j"Q+AvVj%pN8vvmEU6/k꿼Rʰ֨s a=ʡκR'h] ;;W+kH|*(%E›i*f&EI#Yo`Ȋ{2}@1+Eeh˺3̝OC*q˭3VBXVE&H=l$r"y5-n~~V$rOmܚdSyO*4t>g$oeiZ2I ՉSy/U2i.*Iiԕ'ES#Dv1)-AEP)34MVbۖ`~WKOy'ʂ+SDݘXSEo4fέŤܻG]RU<}j^, nk,&{l.-Wε%3)fkt렩ȧPEh56q Vnj ##5=(mt,=(mw#kB PF=bծ@AB*F6ƊF(\zLҚWjVнDpیAQ/wz;M0܂=)FM.8=*yXJ1r94$gڄDg?v\4Nw׮z~ K,ֵܼ.!\ɸlºQ_8D ?2]4̵ҜZEs#?K=+}Y,AT.pL cc2c9۬Ĭ9'ۊQB8I?ybW9n-k=wgBVJAF4A<擥Ew'siIOW'< &k7Uoa}ƭ_Nf?*|Tpt=;穄Ú[o1+Myh?ZJB *M.;qӀ+Z}7#Z}7 wT/%1]=- qU2*sߑB)c~k/; edJڏhmc }ڵoG)iy>{8ii@= 03@s3R+'ZC#‹A$֩hžXb'I˖r8`!^:?JI_ZA-pGOw+zWrZ**1*UVu+ڻO[^C/dpHkАZ2=(qE溑q;R)p<:U(_} RRhR٬aݏjvzW[? oL ǷjO!T^cgAs֛hV\Ջ=5-1NyZ]^cZz7 ,=iGZ*?̓O~ [5XwGmO\ץ~n\dgnQJ~WI?q~F31RyoVyՈuVX%1;u?vKߔQ}B4,^oQ|Z)Z!OLҷi16#+7#Roף;+DZ6r$Z۴nJxTGSj\"T5$枂)'$06x[ސos?'=vMkx~2kLC`sHOʝԌ!vws0;+f9OJi ՙf V@/Pi*Ҙ#4ys*S%.gr-&aQ,O"r &ܩ'6rXVő21,r6nJ5RMe?`~VyFuƳ7SK6c:xKwZ7cg֪˸ Ys湙,bO;qj dɒ4lkzxttQF9D09l_y:o:gW0q[i6ɟ&PU8S1/v'R1}cE^[[H&"qkIRZ̶1rb,W9m-MڣBmh~ǫT.'|;EMu6jޏgAHQڐ/ҵ03$ET}Eoz4w30*˷֞Z}i4F(8"E] u|lNrjS'YOb1]4+kK-[$ t0QPM7߸bۖ~C3U]Ro.ݔ[tB+tR9jGs{<(cZ49vhGeUv>nsjT$de^t f; V\%"#*rx$8+)|xCu0J3鳪Qe/RnS\嶞F_1rzzι.L|&E)M(./{O uxLH BQW\>-jZrگ#Uơء8xWw(jכ2.=ꡓa}Bܩl|V>#"S֚J5YRn5>Rg$ $wuJ+|)#)TaVA$4:RFfcҨF1`)98AeoUs;Wٓ҈ЯQ*FVhҜs.S)k9kqu=RE;LDʒ8GOSW@K 1NRODMkZ3THr}k^i8[c٧.h\ъDCSkVb!]]+g0֦$uCI%5YNW WTПU繎VC21쪽X'wF˵R"+ߚ *ѫMb_^KU$ZQp+0F,z,RD(*k"ɕO.fcW@@+.In.`O5ZODLS2/l\m GcW)7'ea*Z~zW//T.donJm/b[yԐ:iB)F Vz8l'eg֠rCjx,MrsamE(].ᤌׄ; W\dpLFR*dǃ+n5Qػd:x=Ng]fU2ƒǎ.E$FW֐Uۋb|赗5Ē{㰨$D Oh/4'-Dwn,JsהYnKvvDrI#USr-8G߬ a}Tgi*?Ʈj*f _zӷϒ5ׇD،l5([hz+sGӖ溻0E`SH OɉV!k#V쉩lIU{oi23O?ibVJp3YՅ!qotZ}ͼM J+3PԚ(cIP5Hz(>e*A44p)" i*wHgG*uO(HR4UL¨w1K3’9ِN)ыdsqUkˢz *GJ$3MqЎsȮ pUg=C\X<Jď9,e՞t9#y=X'6O/lёdSUle;NCQZ|$q_VwWHn[XTR W֙ i\*%yBYG+ŠӔ,'VW ɬ`GվnT8N"%M[ȞX`ZI#v}, s/?3ֵ0( "P_}*+"c*&m)<=jIP6 F%đ2-C"1һ-J(Wu5㟺}+M܆3J w"C_[iol̑j$[!TɧPVnoJ)9PIukm6sҫM{,V|IjkA.E(뚸eE,HP 8< yͧ<6n'-lqR5b NMAh m;ROI.Y^xA$NᏭA5¡؅KҹjYee9\ξW5ZvۚvCSUO&8?=kB-aW*|gL%-b'*mZ.J޿{pf|6OoO# ~ZZ6k~^G&Kkg'LSSd$zҝTj*+{NTU%? OT5$B9v=>EhqעQjKki.mdfT1s7@O9PeVVF ^{ic#I EGzli_{?)5v=%~r|&+{zFH"VA8nLl۔rx^3-m-?݆+Ӟ hS߹Q"?ҫ]iO#^Ijё70* 2nYlIk !n#Fi -@p;ʺ+}z(M˜# fiT5dV;J8\ > 89czFc19R:;R-F|͠i"yX|vtAiv\½Gݷ"?hHa'gi](ےNE#FAړ _BfE;( Oaprhʋ "4|@LB8U^?v(sUVLvdRAF zI8%%*>5Ih>\֚ U\`VD-з*(Qlm܁MG;}IY+tzHSh҄{9&34~Y<Ձҙ,~b$sQavҕ8)S+[/xA `gY8_Ƶ) RJ98{ҩ:+Si#: Ho9x#vJ}jUs.3֡`Cm=jK.̨XAi0I4]u2/fLgƱhd*TI5坌A#M!.1I4+!`' V*i |T^sMfUm(p s9&a籩YPuql $Q\syi*ݻɦօHS }( - G~9?wҒxDڛ j/1mc+>SУt5!1Iv8L?6&Na/zj~c5F+Wx y*}Pބ-WoBj7fU)UtZRG<6yqgt zdJgowҪ1Q2ܩ_;jlj7HN4GHS9"Nݿw3kc֟_gg~0ZZ3yQ g?Jz>蕱Kk۫1v'e[]01_Ot&+=@&)OpsqI &)1Nde~SAC֞HW8KF(΄2rs9O#ѷ 妚^9#lS]~/9KNT'R**}^ױʼnQ|O^evg$CnQ;d^k.䭢K1CIzJFgVOݏxέ_v|Ҟ+(3|Ʋ.5y8Ƴً1f$ԚJƧѬy(:m UEMt*WFzqէJ2`*HS]Kؒc,JNaZ[PD2Ezvv[DHh+'( QQMYW *Zk`SS%x[Qg+!.;WE*ёaU8tm忝Pl ߒtW,,*_¼#=μ=#k|kgoܣH)5ݽMj1“Ȼ05#AM.)2k=i:` )^(Lr M}˒:P>+N5a9?Jh2+'e*J:ւMoq1KG08;a+rX͢)("QEKnSlc4L~bi}ٚ*s`DOmrBǥsbnmSq*k NIZy_+yiRC$C^Dd̛o$[iΩͱB!?/VӃx?xޡx# n}GY{hxOI ֭,ON?ZϾ}rP]M[kranԑ-X1EoA?Yxd.NSʜ+L#I_> ^i}7yRoZZ?#xxd뱔{Tz^=cՔW52r 5(FTsxutu̦K+#++ z_NIY4fi?Rar}*' I8$(<"+IU| hPr)8 tGkx;c}ȕr?KMm{*[vBY9E0L0G4ȘfiqvBJqe}Q\=(\V>|Nm%E3暧jkE"A(tH'FUWZGCI9)/8:֐̎U8o2r)]r*\WjeQo9~VS]L2YFSӿ.krsޓ4P֝yq8hwS#qE[:#~UydܹxB.'ZdJ~}?ݥH5ӎ?K *i۾U;\xZN5Gܐ9Lnn>Fw*} MhN9 vn3Hd P6 kƼ/ڶc?.A=>ROTs8ʳM?ƭHof\E }ڸO&ڔQ\ڔc qjx"Xsj;n3ԈwRsJF M9A&\Z2?COY7@#g*1IݧMhhziqLd|ӕ8z/9G^O*c ur)BOqW'i}iY#/#FK1X^ Lmv>U\*o֫5n 7essq# C+;4(Dulہh$0쌷qw6<1?iY{J\^ K 17ϭW]zDw%8{mx8ƝWxqlUW&] 3s]$`unf)͹_Tm!"ST?Z!20NV#Ҥhv{9$q{(9!39x+?Pj`KXc"Dҵn\,љWu*(TQUzUhJZ卍Uz\:Px}1Ц\RѓEP"hzRKe9N8TZJ=~ tj G"xTG =iEw?{ңX&#$/g!A+.n)qjRqxȥIyI純%W<:r֬SKx"@^nQJ1xGU9:̤[֨ڼӄPޟzhs?nSWª3}WJ߻T6$ot BqNsگJ㞵 uFWFr1֚bT+ a>ԁr*BA3ݣ"# 0On})T94pAN\g:&rA3ʧ>}A-dzm7U95BIeړUKe"AJQOk4+⟧~b8\Z-Uj|POk)?B̤ס^e$vXw- = [Z72z]ц%D<Y|dzzSʪ(KVhNy9;op.wQz/U0*屻T6.SPdlV*qR6ƤWZo6#=*|QȃU+B'zȺՕIKoxֳL)!M^ױe`[z瘫]f]cm4[((ve+GzҺeuU=j 0Z;~InqR\ן,D)EFyv$ ơwU#^H-~UyH"~N8_Y6=ϊia:i-\=;>2ÕF?P=ъ|>n:f|+DUT⬌;3;پl~tsYz@*X$tVR%pV癍ӥzHb%H;=sKj1Cq:qJ^S;Iڛ$}*)Bueh$P{SUsjL;&5)8\:Tu椞NNz͒B['<8'CFݑ&O̵Xw9ջ+ k s+$uy$ "*/cST){*ťl_riLnЮ*]8,VVDo˶uK.sҋEmbOju+?ψaSR$Le} qi7^h$ C^I6L˾FJǞe(AHz歛[eJV<&9.#_3{M0Om z v*2BIYu3FUy1FiGs4L/"DѮﺊ٩#l_'*x$T " q>*)^bg+Sԏ.*Z 5kFjɵPVݜg23T2ia eժn@=wRntnOjҬ5"fܫ< ~=X 37=*ؓV $-V!} n$$cOYHX<.I;;m.}'F9MQǥ:K/@/]H~^y"9*uԭslG^W+lz͌s'܊F&Dn:(V?Hҧ\0ͽrHAз G5 ܫ}Ee*T!s#:n\l 9B6{k2mkxש#? _ni<w`6߸f蒏2?W3Te'emT׋_gfu3w;v{ynvWVwt/\ lg-NsIIn(x'j34r*H6OQ\3RNG[:Nm.`nw}+H$rdRHclnvXv ޖRmٻM dOJlsGZ2j K:THv ىbE#> =* :m v~T*leR}*E+B@XʛsLSSz+Ky 봱?-co&;dF|^Cme#"2 KhCkLڴN;r1VX(y5FQFPecgnH뚆#!t^>ީ2|߸.[jCF*]hⶦhJ3P*ɂU]I۞W7pRڸ*) Ӛ.(=ճemESII 3qAGp4 uZ[8&Al;O7szC +S"M6Y1Sa7`y-Hkvi'h+UXc1]G52j̊kYLW4N?**"h {hQXZ^VGQྈ]q֤$h5m<zWLN{l+.Gg.UcRH.#o*EeV(OB:ο Xl&/tky f!NǩkK &HdIAVH엀w{WSASʜja 9XuSX]]1SU:0:WM5H]MG^̵aNBj0r !OgO൓17=V1[3^ʇz6x_)qSA9opkYFI8;Qޓ0@yKqAPFLS~U<ӷQt#Y Bʬޝ$ӭ|ú.I YMX[=BHʝw)j!C\.C+;}Z3ݿJ}*w(FidYMԀ*uqW?"5~$MS=OM3~B lFy`?um?խ'jkǝʊ2ot˩~"zUkȿ>S=W>lg nO1[]R pa[RRe -UO^ lX36I'ڸ'RmX%O*~jZOsm/O~5v5 08P9tA+"nXTDڊ05]]SFA-qAڒTzr*_BrilG`V)QIp:n.EIڛ+q4++RqJoU."*:9;2G)U{knVd8!{TъqCE~D<5YP^Izu5* 5mI-c1BU#zTz^ bZ[K}qKUdin][zl׿J( 1w52Jў?*(P)s3xV73%ߛ$3[*>crĕEoCeTɦ_%v*j)KybvpkSyj9s]qZԃkJkfÎ|.SQ?- jv.2TJ5H%'޲Sw^YF9>fH"mUaXCHK|V8C#Y5#ޡ~g?w/LQ${nqNͫOf1o0Շ q'**hW6xqUK7 ڠ5eNTQ4!MqTvgNmݣׯ|酼-']fs֨K]DxLfHG;>X$Vtk 8E1T"~v-GcZd037ˌV/׳KتI*O57HڜT *ADO҇F^6ehYH`nRpvg*핼SiTV}jkI>đǖycSUH]v@t:PL**}ioiݤw'm(;*z^-}TXqR[Luto6/(2.[kʧklm.)~/?+wMRQ\nj]odR;9+8WHO]Vv%U?di9NBI5 5[M?b82y=Ef8UiYO!'ʵka ('֭UqrQJWhRN?5"[=Iߞ P.SSS)`sH( Oԍ!U9l5{K.NᾕUA$#;~vU'9#+cy swB\ѹjT*~SE52eʑzVOE&,|u굱vmpd瀟kA[zn=* ;IQ:S޵*jhR w=mijm!]J\V$J@^^$or9Z[)6JG⚼=8AIJڂZtKZ7#imѕ.9'#6ܒmTu%g<:(N35hm"~xfn7(-Gx҆!qg dxP{;H`T<˕Tc5y%kv01Y}ҽɃ튲} azlČ֍.;lJMaYٕW$OƽNz=l,&wVr+#|_ft陮obH?XGnu\r+,} @“ԶZ\66[֕lD#XGݧJs8 v.Iݿ6x*Dc-.ܹ;}yΦ29ݤ9DLN.\wvBMV^Ф z++]<ȦEe}I ;TMtzgJIs(=zҪ9R4aT|g4hC: z$q8֝=OWi=֪)<`qڥ+<ӣm)Dgp秥#!^cZ%8]y#h7IST7#1L6&-ozeF#޵k>R!vM ***v3, ڬ.G)v] _H'>搒GS޸g+QӱJH6bUoSU!Gv$(w}KvTh+H)&[h[S-ܹMOݼʄA_Z[sE>;RK.TSұ6jGM6-l*v Hs庺SWG_Yel\U?RX}mӃH:tzAfQV~fr{-vCJKtuF&AڽTh5İ޲1+AI$"FRHS;mޛ"g*V'PĪgsUu)O+Ʀ"1"w^$v&]vݒ6\ԗ 1(tZo۶a& @9!s6iWtTs/cRw/\n>9XZYUFܹ%;FhSZQQr8| MN6~V2TeNWE({I:qߧiNN ~"5i30ʢ`{YR$D- Y_?ң9=*հcXMLIqB0i{wsnܚ_` IJ506~FTTĭFQ*vA_^ ^ &\xW#Z `*;{"s㱫n$))"/J<}>, =?Ȏڷku5t.s=T۷S#?κ;TYbi>S )):yl%ndGEl/\WK939S!eH _a#2ǎ}:V[Z-̷p2NvO= y 2c!W$"n'9Q۱9fUQ2淆0&ź\&=,88穩n-!C0cd]W=HKϦ'ȿ֩趍\ EG*WFs|cIvʯ'_\\{۔˯'_}Iak+D'/}g4M4^#*XVjěRŎvy$΃EDOjo,LDqg=:-zR7cUUWX^ xNm0w(8~?.8n4,1pJkyZ<.r;v6ZخVUtYR#sZ[eIV"FÆZ8et5t.C~s9iBAjt4vTz$2'^tARTxjOh?21yZ_t,̼jUQIf8P:גQͺe{MO&=X1cGtfv.KoZ]˒խϿ88ڪMlrїWkږkZM .v\ Y6SKq{HI$V^djQ\cR c>aDM,Uܕ'ZMԨuIr}Nwf$ۿn?ʱjkR{ɦ6$3*tP-M[' :?<^p+=kѡ ==>j&Pb" @>\Z7^$gӟ> @ڜEojpb[D=Z@bҺ,DXw26G";h6EU?N_FP+< B|BY+&K()zlm4hvF9j)UNk/UP-~F($a]3BU$tV4&VI+U/8mvk7Q,7:C<?4kU f5GsYV50џexgT{iMj/]3B Dǘ /9t+_zךEۊԓeȭjFd^sg]*Lk^h~5u(T=y{T ~nK'Z[PMC'c1Z6.UG~)$ S1Jp;qQ)R|tL}k6hU\#lV|TۃNoQB_3Z.hze\>V2-ai}UI>C[)5Ҙ5眚s&<ѐ@UebU:#Z 5!Eu6sFU<{`e;b{ΑuIv?k]8YVU1OU;}jrH"S1iU.j6WZD2ܛq:q/u7Ъ< &qZ&9qiAіܯXϷ[Wa9##WrGiijphI渿"e+@wW'Wi9H{)8'X7hRĹrȠkV9+:'PrQ?>A4Gu{slK[b~OSVB #?ݦ|*E\dNI$_{< UsֲtH<1Rʠ{;w4A43q "{qUNr9JZ11meTul91YNpk Ɗ85H_R^IҺh>Mv%V&Ս'Fudˇ`\W 'r:Wyv 錓\5 .^g_r9?/s+u8)O:̯֬ز,&!AM˖1lΆ"gmϧ^]ǒ:?qg%` O;OZ׽4=iO5;[:\Mv\qQSKIKIE!BE.OcIя)֠ӃiʼnxUkdciqP r,ӡ)$Tɨz&n3mEfrOc:TI#GL|2m\Zy)[M n6zO7[D\t^i5M[npFH"M.=H oG_j| *{S!yU'֧Ҿ>`Zč9ڤۚӫ9y G_V-8'-k_OFґ/e"SIA-tE+\`X@#A=⡶'2W-3|Tnlp;-L͞.Frv؄jI+YPXn*;>ԈZ&VhF村$zҊ5_iWN2h݂urЕ puO[Ƨow5s\?,ޞ‰ɷw 3p먪6zֵI ,,̽{ާn.e;"sG맇{Jbs?)cgJ['vy+ǭ&K9$^zqeM6F< Q[hLz\fG"[?Huq%9<3ђGZlG -$fݪ?( ,I֢e-=JC8Q܈"[s54U 39JTϠZGcZ>vo2IL!<߱K9H=Woshtzc)~Ac^>>5|O$Ӳ6T!H5WxDxWT *}EqPԍ88ujFwaESMGE@7!~^cZ %9 1?g8>Sz_f$tE[m٨mGJ񍝍41#gr_fzt]\Qc.V6$&2ڴlWty[t_znEpޓNjiV2_G#78UKXhjĬy84G12#Q5W^8#?4{r$X`X*.c,>ft2v2zնs(R*_ntaJIUKMH4# "&Lnk7ZAm'޺W֕sLSLTWK; cv6D횫2GhpOjS>"6ߚrȫvMS;Ll :t}*^6+djfvbd6TzٻoФyf,Q;}NJ1? hCG# ;9s}ӎ`ԝkXF{sNl8ڢSSj)nة}ECI2>qVUolcdbv\4V:ӗ*ޜLokhੌ֪֞.Q M3]cDR)A g!dtȧWjzD?grЏZSm0`sk+Z$n/-du$Ǚ ['&LI5)Q*r*c`u/5R(!;m^]Ϋ, /՞Ig,Ė=Ik:1isO/vjCƼ+|Qup vxz vgbŘI9&jr D<= :O'+͝ITw)JNMww= ĒI'4QE-4'Z E. $ jMJx$goH%Uס~>dqQXٛhMvJ99 HܰO!Y˞j[5Z0 :ⶵ X5 H3S8t"k0HbuFȧƾ\kC1v(ck:ֳ҉̒&DRAEͻ'c#̅{ yP~(n#`Pb׈汚KGJӢADF'S^E25N:6R>uW3x]}@O?~sy=Q=iԇjhɩqKHzQ֊=bЍI[cir*!e'q\ 䦮sLg.HjjU{YRNFv_y6R4O­Qu ysLI$wLy(pOzdS1(71 })q\GIZ[v>WVdn m sJsȓwX~Q(ZSzkJ.1R#22sIFPr]:k9,r}k!Kk:Dƥ{5Zq$c"zsZ?ݭ o5myssV`VFQvm@?«Lr1V&0ri kv8,nov74RHq ^:Vv'Pqo#s4]#jɽ幹iwa= ftm[ι/g,F KOS !%ıdTmsʃ5kNkKp~S$@9SkXM%pQK3R֩ru%IswpJDAzWZI-gryBO +*ۼwȸCVzR. uT3#=OJŊcJ}Ӟb3LkI(P6.~^9]?OZA┮( Q*Em-vhIwE =ZZs:ԟJC=i%[W1c٩G)<~ m@OP…WS}u+}B̼$+(FzKw3EY JWE5ޝ%\ʻ*͈lEJf8z(#PII獵3 ̜sKIK[bbc*@SrSZ7a1PZ|2U2T!PG55qRC ( ae?1kjtlWYT;F6s5Y.nBƱ0 s]yEʔ/ WV̎2gH޼öiطJ(BG Ryj/yvJ1gbƽNFOPj;cnWW'ae Hڋ$hp\;Pz(V0rz{veq;gQ z^s35-]l UB]nc doԞ=bn+P sJ^jTT/h>Q]7Z.A:?U_/#(۶>e{JlTj6J$=Z94y{? 4xSOʲϸU+#ޫ<}jdu#9q[Ԩ6* ֳ]Ha5f \sJX]܋t,>bxQܚ{f,OM:W%ZwP1I}e0( 0{V>-B_c*]\]I/= Z%m, %Hf8Oj?&܏ʛI@<sRH٪g@EfӽqֆRיe*F>[5-WHct$rO4.vRF~SɬoC I[d2TIJtQ]G=EV=IURHk'9EF'jkזq%\YsYH1gcJPVBrql *}Tl*g:>ak9DRdտ/ݩ 4w!vӰ;iF Sة ]ڏ;LE0\jir7^[eߘZTG,z5J/yLQ/fi J "TE_sORC:  ͳw? R^˄SjF .*YN,=*Yݕx[%[&ڣMxvW;WbE%DF;SPlSPؗhRK"G{DpŸlҬHv\?8qjW̐xܽ)3SYA-AfGsIl1̅H~_N\H2y5n`"9L:```RnRwW6 q?OD;һu96yOTmx\) +م@c'$r9uvtƶZp4IXnV`H6WVR]w*(IOISaҘe’'(J6r?ʙ*4E_ "o_jSUm(V^m̚=VW$eWw'n\&L1;MFC\|7&m­! Ҕ-ciE6@$9RRBw< ==chc *Y[VG?taa+3eQ8+~OJmԳ3ϯQ]߄6{Ekc/Trt +Ռ# "vFxv,X^ƶP~UQ@t?:^OSRmbiP`zq) =H'iѮH\◥FH OsQrqh3Q9$;V<ךBMΧmf?RkjxxQ ŵJSh]m'v5PQqRkJ>pՎ?Zŝ6vfcv/sڲ"MG&?tE;ZF  ; 2Uz(C/*GeRL::|ۜ3c#kE,+v&c)Քßڗ-C ,(+^n_u)![)"`f,gCA#qGu$lT1\n$".~\sSE=&LCֳ.kzƉj0n=jko$?+3=9<'+ɥVS'U']?Qĕ#9!IX O^!Pm\MV!2DoU PAǥ7)C(i@ʫ桦OL 3NODwQZO?*V吕&n& rUlRiEw=/WFt>B]\6+Lu,q91^Oiv~J*2U2"ԑ9_Uedܽe'8'=]U?mJ >B՝Ėr]Uw,gaڹ9%8#^Òq)~1C#[~2y`TKٯ$wfΜe#*sLbҮı[GdUI#Pm Uai6Y>*{=hF֌O٥;s] UzYŚ\mO2rMy(kyVauL})cOrAbpnۜZs鶼d'vNrMl#sC8}D!;~N5ifuѨSGD~lTW#?ұ%F^ս2sg#mjÕU)t噲ӌ`߿-" V <5Hc\tǥl ce.sTf˼dƨjM.95׏o|NIjkb^VcP Vr VrQJX9Z%Ԛ|PsiȗaKM^]4I"?9 0OR@Uf霹b$,)$g* iS$Igxh'*IQ3İhX6YHNNA֙S ʔyM9I-Yj[>I_FݜVİCL+uDאH/F*s/җ#nAzad vjጡnrt5-R("mcܱ!IDwIj*JZ'7YHA9(y- "cO5I8hn 3XZSXB]lƅFjY &ҒR׻$?PҤ';֦'%zVf+Glh}\XKug&5MB=H53"Kw\ZeIӣnO9/n[Y_N C 檖2t-vXׅ_JV/Ĺ/ʩ:JK+u(f :sMG j[:Isq9sg"7&rjX|QQkXV(lTw/?ra#;\O]+on~ [ΝjZBrX%ZuqCp O5 :g©JU*V;x$9g33w%I=zi:J>oZ'MS揇S]A1Z'.x'j+oM$vq,%IT9ϭaK##I#v9b{c $FvZ\- HZvnSKഅ,*sm=F;U}F;7WS1$J~,GEWw|V8gj }1qM@a}c U Q*%L2Q]ipQE),wWK8$ lj:qҠP/AW$ԁJХ{ZIj; WGz-EeVֳ[ݓOKk*Nq5ORk]wjV6 -{jĶ27\ӴɥGgޙcTL[YNd?ΦxܲsUuh'$#/(Bw R'|=%2HEaeTK++.\w<ί\,QDC(_JՇ_,rzt5?^ +L)aڻbts^AXTzdms۟8ҜRU?cҔQL"V5rip<`JQdD-mv!faP4]{zwQ®{n 9"tW(8(Zʗs%]-~ǩ0oJj6zVfdqHm 4RſZ7, ʰGp2PKIӂB:womEᲰ轳})vd ws+nJZw%;w1\m_Cڢ㼔s=x= i_\fodF~SfD^1_oB<Z r^ʓݬ6gW*ɷw9Z۾K[Y9bۉd'OWOϡ@(ɯ6>9ބj siRpM'JgFS4zsŸJOt>IvS#Pͽ#UGu-ye۴휤gr!Osե: >f)ʏ/ j>tRCrI 6ćiGСgYBODR?pƫp1T>=kN-FT`{}UD5]b(cT2qZ{zяhUw7]@f(1SM;ɵkm(/TRr u<~B0)zErJNNrwl}ߓ)WF)R7wX¶ⷁ|MWEߦjD`ъF=S2ݞY$I<1s+ֻ}BO`R£U<7gcZmgח1J˽vG~i%W獾bU`qOTU?+fK$)A,$ҽFo%W*vz߻0;r+OLN Jo?u>VWtyV#$9G> f\Tؤc}]8'+R)qL6GnQWq2Im\'ݬYR۹ ²wFsǧzp`R*0r] Fe'jCU<;u-G#x`!ϙh;0!(h` ƭؓSRhA8 [mHUʍv<aZ19oe8J1Im Hԗ\r8j t[vfX9*O#PRrC3,iW%tPSDRyhUʕ=xLW P`Wk[&T{9F7t -mj.Jg+ 9ҙ I,y\VϩC&Ю+[Kdձ[>B950jKUymScjёkZ%0eUK`\mPz\ nvg?z)qAhP !qԊnQBeON ү{Ě۬ ®K4gI^k&j rWlI^2OFJH;9n⠸|;GJ yո* s!?µ?.O&ՖmgwqsoZ~Yw|KU tmM2N0t.o$ jj{ ]Iq* 9(ZmM6E#&\szS졷mȤ1jhq8p71ӄiH>o;r}*%Ԋ]JzMЬt 񹔮?WUTk )5-F]nJ[!:gt*J>zʑ":и Vx-ǙZ֩(Y@1\-=zt?wmcȺF S[&<*%g`ⲿn;?طߝmB?J?m?Xfok2?GٟU ʷNѿ7]s6h1 ˷=ڷmRahdc^5<^>8#?}C m[ojcwmnG#(hS'j6>HKSVSe5&Qp05 ѹ0xm-2OWad+'Y]Vb#qQKz H8UT|9qO H{e5 )JZ-Ҭ\"gۚZ~ϸvd f}"ȵ ASpqGZysd\!f=Mltj[sJk)+U-GQVv#0j hFCOlh&Trʩ[Qd~OQOH_=:腎PS$*e,I)⠑KjNQOCS {fVxkw+(^nG=Vnl(n۸zfYp}IUjI$DE$⫦hs/OicD;282 =.!+:gXVMKr17Ö["]WoiSGHf_kEq=RQUԏls}P)l?ZehH8QOTݲe 4hcn~Ux];6:fKiyVR|]<r¹+{tHU5{vIMg?*?ZYmlfTX$?ƿOOҖ(䩑J[C>+0KrlW*brh3*qʻw'}+w|Y9ܼ諜U}7OWoU ӟV_ b>iV#@{S7o4bH5׹"**"E :Pz.(K(Aj◵qJrhoWby T/E?5x q5yeVO5]ҨjT"v}ؿI=HBqFNRCCt>EVO,sZyMC/>i>oi9ih*=)FHW $@Gg4T*>}U.Gu ަI ;W5]?ôVUc+rU)1N=P.b?(gb෭hXj7:xH:>r=EHmGM$N@srInNIDJjcoL0ҝpjPy6l㚕_"q}SڟQ )r)Ǹex5iq& OQVY"%Yyv)tu껚BNu]v[V'LBpa=rbXXʕ K4/h$$~CFz kqe]U{)6Z_ƶ8HWa궺Y_y~eg?µj8ȧ۬Q\ ȃNMLrMz9}!H𮖶ypfa3+}OZQjV~TZ XkY0NF3ֹky ҝ ݉RAnERg]`g}b,;zS }LTqɴm9B )F~K~d<*14 ![?tty\nzzyS庾Qİ{԰3fBJ7ҦVX$aUb*(Xx VrY6(SJ[7qՇ.D FrPW^&*dtI*GmYܓXh~a[Gcִ|f/b}]{:_¸^"ZCڕSp;^=3h{Rc=)I84?:UzjҩB ֜iCך=*ޤUpH&[ו:ZS?Пʰ<7n.1'?Ҷ|8YgSÜ' բ><*vur sZZɝ$'KȦKFNΥZBC~HO*\Q-WPl_tV 4J<ԡ7 LqO4&#?CҳS8r .jn`X~r&ő͵tyҕ9VlmA'10$+:t5%og.Q#;pJn>DW1Fc>~ͼ<~hoýK٬8c61 :etg.Z{3:tlhm:ԨA4'ܓQz#O8w_A%ĶZHӤO.FC'Jz;Ԙ"QEd|[;r \M NF*HQX3rW{)B1G 2p|hEPsToOEZ鴻fЬa`G?֭å[,rh=ꡅ=̤R!9*m#Y̅e(xJ^*Tq,.慑CS җcֺ"Ibhr0kzm݂|zb0tz-e!HS5Uɛ֮9ӑV4BӋ5;:o'ߋMA,| 'j26AwX:V"ʾ.qY1՘ 6յU.Y?uqvޠtu|?i\4iʤSeP2>l(9#-VIXO&~bxAac@~_xUn$h#!w`z*7H$_?ִ*vУR;(Y\>;<ǖ)k"]:]Y=w>*ĸQN/ jNd5uKqiWR3BpqJ-oti0=||!TM#bPFCcMD+Wn&vj٥6Ж ]SEхi"Vr5M Ǧjo3VXcONJ7K/Keɫ&>{EKPH|chڹkEԎ-)1v4{ш~Hlg\v!!*yԼgү1NTGZ~XS2Ր] *WwB |l#nA^[ȷ SpL6Eiҗ\'=T14E.\<d˫˘"BVQIf}J~o^ 1Ispڰbx#iL#&C9sQt쵹)Nvk,Os]j٦<ܙfU1 _hA^5,5ʿ˝?VZ>H* FqPe& zq=$QIsHT)4꾦kOj-ke+y'8qr\B3sEd3tMydt椲V#R-! GEmk1Ԋqmi + }=:-,szrR~c] ҪXG[щv={WF?G2GS%qYG֩a8Q*B"qN"~f~5 NS\-?ާWgv=qy5evu!kW)zw%GSL'w'5z!忕g9T8Ǚ1F34q=$WwזT\eOXa:Vbm3vQ+ [9*3ie$WVr B̸o?ι*93*6VVM-o1cJVXW+xZIR5MyuC}pcF+W=zP:4c )Ȍ6W6zPi ݎ+GV[yU*n;Riʥ(MO4FOXv̍x*j2'_TZL`VU}ф~ɍW* Hm"w?@IwX3ux8Gt_3>*`*.2qSR9%?6~Ƥj#{EL#Ȟ nĬn}٥֣5FC+9(:FύAȫOp(߀AA5Ǚ¨^1NPߒmVKhO=}jݤ$D%W_E̥ 3oXzݫ US!PcL"`Xuil2RCק[C%r9#,;Sr(ƗLUmd$ۜ\7ƶncQRx~h'#nT ^vxX?o)*Ut-E_֭`O])B24˺BM [y%c5:2O<9md??V9HzRR %n͙9whzZN{RE-QYxe|u>T/AG8XW%[aJCů} Ž$Lb+7WC[B1H?#W و*o{q/s\ԗW 6T5 0jlO>*Pܹޞ]mCw$>kGؽCs_\4:*pzTvzqʐ"{zneVcW i NMK{ہ\*.}$c;P&FBvɦՠ70ߩa{ګ,OZp*-*>XưBoz!ёwI!L] Ԓɽy%zSU*,kQHլ'4L^&Gds+bǒW6NM 4s9vڵ)Q {=}>q\҄OSMSUqW{c_j %U\rzS+NNy)۶rv*jm{Se@0QDڎ&n{{R-VW 3A**eTl7Ҩ\wV;dيg=MC'6[V0J.Cڨ{!* uc _eR+姫$hcgh4/5py]r^Ėj$p}k)-{ڧaC%ܜZ +쯧:UGZRWˏk֪8ыSp#B>{<ɒBD`z-#KyhzBDOj?cSklGrY+Dܟޟ{x 8S-{d翽LNJru%&s6.yUZ{JAػި'~{ަwB ȣ'h)b$ڜqҮŦA˩ⴅ:`Va:qߩ=q]$2J)I֬+kkS,r̄(Q`UM/Kծ!*}u6^_v+(V3ahPpUB#$VF<E SQ,Qsڞ1WiOgkiqw'm ވ|?ޭ,q"r)9vVojQX#;JFvVyf=X'BCyq1䞀*h.!mOSPV>U"jwƤTy1W8Q T}F#cj?/i1,Iҩ[^ڽ[󝊡OcS qGeqJ΃:]Q(dDâ2,5y$ kEo-$&!O:҆d0"ȫ5#}=)hRy:9pk]%r )Rc^>Um5Z T8ǥ#,69Uiwg)5V*Yv( 4FIݞ@1Ez )rzReVBbE4mqL-A i$oLv/hV9ȗQvVDtWC#9ZTj>gv9Pއvymc O8WЧkX(Sp6?c~L u>ԊҴ&2zaZ"a; nƟHkfjЦd ;FjZB)|˞ \eeq .Fn[c5RO_)sie J mf]Ax UM*ؠmSWsں Vi ef+{ieuZ[1,}M=U~TA` z1HU=JȀ 'oOqƉ J(*?8ҏJׯuf唀vܰ%ʎ\5>+y݂rkY QvѦqNJo]MU.#oO`wJŎyK>[}4ìmQi~Ur(>_Z38p!yE^ #!Ḡ+qW=aՕi>F5qF^}O? oݤ :56#"ԕ C4cƺ=ipO^˙#_-绞U6$^v<,o}Gzh֡:U$6k+$d=?]Ԭ{S"F%F;YZw*tnmF9c/y3d3+";HRy>kmљBfF 9[j2N95u#.zRSM*R})iTҺm&BBc.*Ua9Qҙi¦_{zT5-җ;^e^N6>VʞUoueeF&SD5b֑BݏE/g F"w{r/sH7 GaW{83Dzq̯.t*'ޛ$p|覑mmiIiIѧ-\PF,ղ2?? ϕ"o5oʕy2ƚD`~4w#V4c&lwEja#@Fb /A֗O&zjrSZ0nM*:UXҥ Jh Hii)QRGAM>!sA)4{FA%hHIndg$XTRxTd"5 O t|rO&MiBу85\wa;=$I IgfsZVV#Ϸiܚً1f9$7ۏճRGv1~G5j@{W4kTrƴ{:M);elIk`f>sXt[y?)kVXݳDO]V21L0:\\{n?+Gu浽)u5%k4wco¨^Yw?֛k=B9Dz/[HGlT!WA`@W GLL QJ }}k7N} ]4FvIȮ;a rÚk:Y3[\B5GJO)?G<=)Atw2r巍S>.t]Tt{FIԣ/cM֍HVD.R#hh>҆K# "ʕڭEG$>Ux') m>17zlQREYa,NTQ[&Im~˩+Q %2}T8$EA$%}=H# Od(G1VX~ZŹA [^ЏPO6uُ̟P)=XS)9m~dO1%FN,Ux%"VN޴V^EQYIL<֨*By9$cvxEߨmJ 7JD!D}Oo¸2 eR#d?z\D"7*U1bBܓ#7;I<թ 9Zd=+iSNS{ƗMctn$fcډV)'s`u|BiW%4#'?Sexbc'ҥrV"yqQC1,pA◲s9B{ a7owV^ Dߏj=-ؐF@,U-ⷷXGuEsTbֶomR2Ȼd_ְFx&aǏZJc%ᕢ :OjDvCGw> SSMQ5:4lQԫ/O֧1S*+?Ơԇt5tL$GMb|R5OϺh{W"-Ic*>ނ?J{6;Ɠn: \Rz !!zE46\u]!4MfT$ ;6p>ITK&j*ڗB2LlQ-׼K-g.vOQ &%;Fk:]:2fGw*~B2z:4Mkd'#sҮ8|;W8Ia=<{鿸E;" ?l쭑Bc랖K9yQ[!eQNUIcUofHUuOOpF|Y—|Y2;Hv ymGޯh\E]iSYl91ȫw1nCY*gj>'!?͛HUgi-Yj1NWVjLǁnUfٿ1_[=[ejĄ;I+Uz䨽ip9棧2?01FwOzֈ+Š*kxGW5DF?@R;GD}2cgiR5QaV821I'NsKUoc՜ȾdE}h88Ekvė*9_oֶsڡ\gHmnvѕ G$ m'wsS^> $1Jm9>V[Y9usY$#1!vݽ[H.TJ*$q/QCo |̣3HÆE gQ n)sVv %g#qLη_ǭm5ƑP_ƨ$k2ČIQ^iVEU+j/e-}_ z]l; eub?vU ~4kS/ON[d[w5s󭟪3UdY.gS)3}B?rW溂˷^<bWڧCkSj:֝Õ\ܯFbs[aSF7§R3%O˶f?/ST, yoCP8~Խptfq=34פzNV_2DX6OURiRE?-JʈF\tS6N|֐#? [c?Jo<6WDiX҅7!Kc#> ZC%E\k]"E^WIl~t<oZA>vLbl~X?HW_bj9jd9Hu-h3dr3.%׆|O'~AqSi?5:b$O!?*Bq8lMp/ 3m'V^Λh҉z.:X!8US-K3[[X~{U8Лo1v}𝠂!T(E/lFISQ.Ti.?Viu?5>m3f" ֈȋv8 Lk^<#LhQnc1J[)ʕXtj o#{kK+pEEejZFOvcL5T<q-̠wU[r3['VS"six <ۻ9ܛz!EVrd=Fz Bdb')Kg3f3Ux*J;}3Nܪݪw(˕\(+-8>成|O%RPB5%IВ#=ǥmkVþ/?+s1):TY$˶1z?Z[3ZͼRN^ZQA^}?U5hw/Bke*|q׌OSԮwɕ"ZɼGEzVދJ̏+H0?*y|*D8ȭ8|+f+{{Ȣ)U>.$A~G֯[HWM95 s]4nkV-cܒ6V7 ǽW?Zd;#-Go5m^xl:s+A99[d QiB77S>QKJ}@3#QO徘)17Oz2*3W:ዧNc!dPGiz/#iX\5#sF'c}[gt۳ Q62 --pۊcuׇ$zHuZtNk>78+n+8ѭo5=8#V&ݓ:Z2W& V*`Ƹ 6q/鲴sJU& ) z.َTGQ]14c,yǗ!B)ʜQ@'9_?."''_#i?!P t .Tݩ)Ws]gYd}JRs(RP:FiZZ;RRQڎ{I5vmd`1ּ(#@=ȃ^lk|F4+pW =h!fP?*HbvBRN $DQV"U}_QLTuozJ Z-EHk_\v:QKq}9?֣Y56{UG-+.N[TȫRPg$|ʥK'Z<\$*7f\me<(Sf$OZJY$,p*bfo1df}5qi;[a0oT=M<=7 +mEC2jS.>dQ+>+h5P1!iiM)_YRFQʞթFOJwx9F% d1mPqzWwlַ/ =}Gv|ETL7q{~5K&Tiv;zFv)q\68,sN.):NUM z׵'v ҝ*EJdm?P?lk4Az nRݚRL :)V8OZqjYUyɨU ;p9!̘x֨J[||5#NycNyCnkۛsKPiBHUUsZLIOmc__^-;@ =MgCvNI=I2]${ՀYJUe-#T|ۡ& ,: }}Ui2ŋzNgs,qf=E}Sq-K1J1Ur9{nz!ҢpMZ^1Be\b&rr}Py[xͼU;}.Tas3t;~h*)K입:j1W\hw}|c7KItS[iv q(WAV]QNH’T@^j"6zc̛H_l"PCoN{YXǁT&tj֧i,3J.՜#Ȕv##]Ŀ()+>X I/_e*$ɨ#2NF'ڲn5J+OBg$koU$ԯeBM܌UOucI#b*z\M>Ag$Q PYN,*&t6\Hşq֬YC2(#?utw< gpKͤE$MR@yV4-}kem"Mt~V}"rswɹK)J]tim;r)ٮj[m<$S\O4{(P:Ҟ(Lc#R3O"lWɑ ct 救dBS>#f5Ƭ9Xҫ"4n+ W` lLgcH܌n-ỷh'@S\3۟QE Kkky 31?+^X?.W%*RG$jѐSޕ*9>[tyl2r*mי淚TrrJ>^kF8Mu76GFu_i`[Im ;N_>b3OJqlq穩xuJm(2/]ߨS5S*s^M(fnl❓r''ָsNVF&C*q bum%ݬ+!'5oyCO()#f9F*ŴX@`Vi }_Zk9ajz#8b#}4_ ,ܳH䑳o+hB; .X%'^E!c|̮U[ma~fS. r)溫`wΚ#-Z3G#$QBS t%핑bx#=G_.Fҗ*29R-[?w{Z"JWJ8ҏ,ozB.AKkV-\m ~U g%U<^:隷i+kGrE Xϣ#9=h Hi]ؗ.AT%EsY]C ]j $$(4eyG|22#>eqJN8~"S]YCOӞ I]y#"x5ĜOҠ}G,|%J:qR+!;1h`trEz5亅&#S;0>$uPG;aV;zZ=ɕV4 N3ބXeM2튧kks we7N,[ˤE aGJ;G$CXdc+vWU#яOZ8zd S0v8>#%~ROѓe^PCmU98VG *Nh^i@$8Mٻ~`=wn*{&Sӧ.VJ➋nClĿ, ϏR`|2/UGJH 87ƗToT7fGZB9Sw`₅ K<އ`q}CT7}o[ r?0:I$Uk>P}*:WOʩ5m(Z6) ˒ZMC}*Un\EUҲanQ+VmYJا{X^S[ 2,y#-Ip.xҘxe)͹d&OS{>bOsR+-]'ޅSO@)$ -h_Zvi6*H8Mҩe}))j)1})pJuMyC"ӒN%NJpiRrNqTvNۊkGFzե6u=+f[q3=`yncW0}*hCFY1B QN<6.1Ryg\nэEGh\l2.ο֫e$bڍw IykfElO M;oң qIʝju3 C>V]$Q*kTHUR)*8V>'I l5A:)S[#|*^8".^.#EYӵK9ѥ*ySVF)G$0ލsBjQ>ȫPK{Y#dj~ VWĮi+V.G]V9kZv7n+~]?ArpW{ MnQdz{8꾇SǪJ14o]JJǥ=yb@ybIGҶeXnV{TG:ZdZ$|j*:֏+hPVm":S9=By:I!CF5դ&/e+'l I]?-tG,̌pѣW2F N)GJ֟RLXQIKL`ԶSF4\EM+JWwBT iy 6܋#"y𜐧Ҩ[ۅpMfpOSU=^9Kd!Y2^;X95Zob-̋cnlqU$~H^XIasLcUe93ޙ95M$uţn&ubNNGQC5{XDŕy/53ެP<1lI=6WUܕFRJ0`׽z-=6c$uPڇo-j?ծx8*72DZ,@Zȶ mbʣ 7f%'Vn?qςpe[GsdSՙ~_i ?6HQ]PȬ6åeDPIu{,ǓOjUGU;БX؉Ք]6pֺP]+  b9cC犻~[sFc Y:w5=|m/n1֩.†.BUp9 sT_@wsLo RT)%fl L,v4 ̨e{;ŴY)>C.cO_Z9>o,5~D*„uVES*4L[IZllFCwm%elEl4K27'-C*Ƿ6\ZaE4dq"j?.\?:ObuX?z4c/>*|`y{q>;gP)=Vuhhb ,$ʯmf4LO# խ:OZ'USJ+MԎAA2I8ߚEc"K ͻ6.GW6_2T_qf1t6;j'!aq2JG70ߝ'( 1JST(i*6Ͻ5Gg)\zRƅhoN-ǥ$]䜷^Ni}T? ""fURyBvʼ}˴w^EDN\2+~+\v9Y4QFX-ynBypOLW5W K|Mj~Gs#olr;ԗp4.J5@-ү3W:t1ZԼ.M2P&Z8R!; #] 3by+Z%Ys+]c_B6>i(i40wweڶr`8,-\_qjTj;?ʆ."Fw-dÌ'o[6i&Lg X"Cٷ.](*Jdӌs48:둼]Br&e/("篭02ҝSۊk+E.qXMN0cQWRr)Ѯ6 S$Bgzk"\\99=1P.NN'==5ҧJf ld=i25q,\cu- ֩-2ۑڋqO=W֥] gՍYy^$rD]qXic^|y*ȇ4B7-u k2R^5Jvm*;u 5Ǣ BcM&'yj0eTQ[Ј\zt׳_3,eMǩ5Z,~dgsfҫپf*]1KУqrW:BTF8Z6'Ҥx"M0T"z3=)V;-"1wn#i<%geUas*!*'RsY8-Y5=lAG5i{*iw=,57NZYi5l7(8>^:֎sR$A'nO'\:r$0VPEQ 5tp+ɛ监\r!?HTԷbbQGjʹϽg֪W!GJ8:ӗrEn~Z@. ڞn@ߊ_qF=i:du˶Bj듶)36zbN6p:,Kp7^Bbr7|uK~~{C;FG5r;юO>Ի+pL.nCsIZK+ךҞ&ʌ[&qie8Lz}k_Kc OZ?c /c zv<3_EǯJi$ˆ#,MI=j&'+*<2OȱΊ1ЊbH'FRLާ$TrZ̜u.:o IȤUKBAɅO$gLRZ $Xd+\WY =)oRO!fdڹaˡ95GA08].U, :i*~Q֔g ݚFnJ{gz]|"Ƴt13֊=x92J& ۚ|?: ~)< 2@qNS*Tkr ʸ]Ωܞ+h8G$&PG~*HUU}*T)ϙƒs<Wڸ[WyԷ}k'-b2/_J4S 4$g?ezp5I^OzLjO̊O*Cr^S_r.^SBO/bry4NTt#rKĬvjV#,~N m$ jFqEs؊iNzkIE_ԛybp̎vjY3/cޡ\JSB$,jv^>a#r8Uk< -廪'@5<'*u$!q^J#r?<*tmA#xԾ!<>*(!s !Da#PvH ouƳ$C2mU5=`еeIa0d*>bƺ=X4!Iy1sI UlOc{jXLW2,mP܃ޝS'MN?7?Ji\'9*O\lӬ(SsaO=mVcbY}jm)r'*)Z97vi{i  ?Ry:ͫyJ'OIn ާvq>a8ַ^\TUN3ۡ[J0˷e}+_(rDQC~,tTg%OAQ J[hj%>JV%iݷTTRQ#SY=ă/r{RY=ĪVhD8}Moº хº_UJTD6Ƽ)V>v@ݑ}kЬ,~QSIImLpj/l}­ʞC jM=Jօqi E KrH=}[XֲlW >3"Po*y^69Rȫi2b[{fɄaXMTۙt۞5e1ivǶҴGѮS'=ܞ8Igƿpk+Ě3ld'" VyғjUh r3FkGr]}k=dv8@Iw f1-+ NQET< ԋmeEQ7b& ɥ3foTq}ЫGiTzbVX/ $UnX}=){(XVF+? !ӚD\3Q^C$-Ecaݑ:\\>f>5,6?*>F X6ѻ**^;үv:+VoOjnÿЎ1][t*3ݢG]}Ko/"VHe=DHxM)Ӛ9U$q?¿ U9昱2QoOX ,~ⵄ%ov'T‡YĪOq>($MU bE仸A *h>q< O(2>w0HQ1T'5~r)nO|(b?95Xea&r|ͽ&$#V>zaieZsd' }B4\SFn?!NOU<5`2˷VCGzzCcW*@i˜Ԝ\/Z*:"6v˶ xTՍvv}v4b)J92y |N8+;*?qU9"ny5*O|T"$I`e^N}94y[ dYm}QkзSYQ)F$S?tOcoi#$kTm^)z8E(?DpqO?y/bUDBJ~ccA 6)ƫ f?XbuWK4&TC?J勊gM8<14wqa hcZsKnH`Sn\+˓҂ FisOC[= 6qiA{PFj1ǪXdSw#c)Of67QJ2e.M'ʪjmcdӢ*T`Yb8\or:E212F=FW\Pմ(WVb`q5=u>q4'UkL72D )_j[,&6]sWl2/*FEpXm"ZtF1ְ 21R"UNkTT*)7-Ql8 MڇεcSQz96!r޻&YiI&SY_*^;0)T#SYneM_NԎbZ_,s mzǢ徏 k!W޲.}jS}E],ڴb]T5c+;}(4)gRɹ}x,(IR}1$#5&J^qֵWQ.hlFjm+.N=yXhܯt?Σ4U-Ӑ=)ɷOFu$ Eh5R/Az&H.ߍ\2lZqRC<#|=5 ;$Z]n"Uܧ*{wV97GJFɤ8hY38a*1拦;J8*{hTL2Q[tGQcz*~U54lS><(b98P#;EJiKTqԥ*2V ~%aNVWsM:Kh&]wT*9S42A\BÊ1“s)KO /s&-7Ŝl2D\W{Ky9xff DP`ƛm1Č< OcTMk"o^'bbfɧ?UT+GI{)YJ*x&♘۷ .nX;y7hJTzAըcVjC&A뺲CrP֝śFEXy(:oTEJ.BikUՐg D?#+?)8:R xxR,,_S;E"ꦗtGb''WmUo&XƬ%W9+kZqj.,ڒir ʐ<t/CȨvD~V>Sl,~L("e"y? bIJPqLaM ZFW; #c'6x56ƪF諊ͽ5-$U}͂&v.sڮ22k ZsUc<>TH[yI {W]z{) Os7:LͱYEM}hAH'=8Hv8+99RAbR$FЫ8ө)^9J%ծV[.$V^r1~J6=_NHY\Q+N lcێgiO^(8B=Pq\\ʋUך#v0dƿ1KU{H4N[* aVaJ`wQK-^sHNŨn'19jz$@ J^ݛ1Z0k/_zlnb=RaݷqjĊnY'067Է-8#娥bޖI ,#Ȋu (Z3Z<u2),R F_7NHVHc-Tk$lZ(fL{$۴ '?| Vcm#2*ڷXn}Z08#\{EЛM[=U 3˟ֹ[^Gm%<9Gu0*sNk3DyokjzT;}*<%Ug;q]wfԵwD9ҭ:Ŀʭ>I",m3,6ӔdRiq1*scME)I#*:RF0/=x3*3* VۀH ١ zVY\}]T9uf66C+(j ۧT!yyєǚ{ҙ4Ǔ>y2gXwWa]p}#Zkޢ#o9,+\5˶9{V9:Qf_8GL˴p*2I&ۓV`:RQɥCCml^;w 9r;P VJT} 鵊dUqڼT!SN"!C5V2<3Fj̤@*;ø3Ls\*:UF<[GMf[v^ޓzME1B9>EJw3*q_±7]4 KM mG iE0~T_¬ĬsE \gi7'9_[5˸T{Z~Ah!Az?;ez2ާӴ޴Eeh9zXb[F^4dUcjH",gF#r'9_J]FyI4ݜ D.Ʃ`2ybZc jRʂSv029m%4HS3zյQ|U/U9ެu?.OEa`G.߭[ϢT7-'Z+3h/B HYfw?1K+<A5!N+w8lӳ*~̜֭ Ufw\…eOkNwJ~sjUj;VrH^HR+JJ5C]"UQ#縷+seLM PeVTk.UZq~g<#zFf]V8\Q.z#1Pq8n?3Z%SJ Wo`rM]QMS&$]z5!?0Zjs? ]~:ݟ͢HUo-bqʊrw.V}{%"U|װca)%S*XN1^ⱓu-!/U7\E®m_+qS5+bwAHƖk47{VbU\S*ɨ|W=YAD:49h1NO`y.#ٹ}miUnT=NqUkXMMخ|GڝȂN8ګSlesZ!czqP$<`wwX苍ǙWӐ:)SiZi_a6:idٰ ''\FSsWid'V{^Deqqs5eiQ[;A*eRmeTg5N+Rq*A Vy 3T<9v!Ez%JR(Zh$f@Uy:vs*F`hbx'ChWT-ESM-VTDq`3RGtQN<= Ckxb/@䩖F㵬{V}O(Tz㚚.fjGu=~QP̖ %j5I 泯%#WDqYZg\Y,H{v:ZE~G"Ҹ[M2 %[kEՋBOLUH+Բ:Hҝ to .:0xis†+峜2cױk~EUı?)FVufPty<蠻(qRtu]2GIe*3Oʲɀ+&St^ܢVZ7rJnVPyy_zT6l{W)ǰ iyh/P.%K41WC$y"Th?J>EVy)R4ҼLZBئ1Cr(vIklҸ`'Uc $YVZP5;"Bר사3_ܬ.I{(5y< 5m PYH搷_opEԅXϨN)T슯$+rcN'|N'g[開#$z-#k-pw>"ԧY%=\~k6IeH#I5-QwsT\@j3R N<m9^M;[)X]J챬 ~cmR&Iyw-OF K¦O5e {qJn 4#m<WBR2錚Զ/e1SCYf*OJrrޮy;~I(UTuxVuSj%s,vH\>xz0ȿZia :pƣ֢UʡP<6:-ǘ Bv5SEyOXԜSzՔoLkM%>OYR ;w“Zz޸o-3֬kkinXm,NJsHYjo 5v 9wfRYUDU^8ⵆrzNZcK#}[[vдȮMk{5>Cn1hƒF04͸vClTڧے1)8ti^;iх?ޝ'Ige B("H֬`{g+TeFrv5;8 zv'Z5ՈN2۵xҡoJ72N(s)NzG5 I*')u8TY&?/8!ۃ('C)-G{mA6*x;w2zjI.:R=?%#Z2 ed<Ay\T{6 !-Jw'5}}YITE5s 2V`q+,1ϩB\sr}MnjlV8ɮQ=s'8C&E)*J7lPc77QG1E 6r[Ɉ6gh#08KK[b=*ەHH*qU]HOv}})\SvF8jԂWغLn9=Mrù&ar{?6K&/YA'$:3ߨQb{V;0ԣ\ϱ<h䪱\TI!PBRq-lcH=?J'jWP3DU|~T'˸9J%[vA+Ռ8E Y|n>=7LlN"mi 7gh8I|lu q5d9S[v4紿E)Xn V:)ʑA1ADJ)3Ҏ}i3KLcsNȤh#(ZBIڊwZ1E{QmzRHǥ Nip3k oaHoZ~8S|/?JW` |tTqI{ 6oڌ$l9++f{"yySvORԱ4y+c"XmVP0}HdEt9V`?ͿJrpAdcI)R=\qXR~aJqٜ>&JFjm'dh%[\Y͵+k C>\kAO+>C'Rә:5Jdк)V +{C!E\mj.?+>Sm2H܇9I4bH°/$Z蔆Pj9! w(EH;ΪܭRYGؽ'?=y-{k9^k2\ۤЎu.ɞQ69y?gyʺy3G3x?oac?O-?\ȂC~u%WK5L񬙉ETPZt&TQjPF:L-rT]N: caoWA{;mU+ӯ5f|.֜11tjj(Zh#S뚿̽|@Xq}J5:}^2̀C+,YZnI9InƪWKGXҵ:PN<7ر뚊[f^+TmQUTZ"izoDUO*N/cfQM@Xr*8HXe] Y('(Ѝ^)wTIq|kx= ZLcn}66E%#sUM=P)5QEHb<{Sq\QImQF)QE##iDY*&dY4*Aspvy?R.x߈u/ZQm'5&W`O.=7r_]\HE[һ~9@f&~nP*+oSxq*Ud~Ƒ RqL G\f:b5g}:*:f{xSa~S=FvȻd9[{v(协 Tn˂=W%J[l ʔ>. l qU);8OCEUG(*J3 ?*μ,D2ZֳuoڰF{TJ<aOQҘ yv<ҫ9Z39 hܠn@`M+dԹ1;4D8▭>dW V\&sk 3q^w߅mRFWюPfd z==2.媺e,OCX~1LeKnl^~+d*Fs +ZhdGn|Nv B~"I+,\ Z^&GE*Fu+펏,I>ur/-~F:V%nJ U]eYyR)%|E{ʔ]g$e.mfo 3Ud5}XcjwbJlTvsVskr/:ݣX}߭U;QR}j$a+TgGSO?M9(Pks*]ʍ c[[N ZɶՊʼc Ma07=Oĸ$9zuj}º Vj*ouB?2ZC=T敁X!;՝f1lZP0jFR v*&:#5`=޽ gN\TgKꥉ.IzچE4t{#J1֮i_k5)RiޘSsl~duM7ꖦ3Z$M,pQP#ϊz&p'v揺VRZX…WGw œ2zҟ{UKȈmOZ̹ڮs[ru;eEV''5ËDn&&`/C0?\-&9;JeJ}+f+ݙ9S6UU#CX?*Keb#h:QjrZxR4R$iCPU5Y9*w®Y28[+O#z>C7/OR'|Ո'UCmz~5- y9Mմȵh<ض|dwN>oʞ֣wm ܱ8Uݸ{_a5֮\sIu2>\4б F Kz;'.O?иLn9;kA} Y  STq^ {ץnM5DO/JkW6#(עL’N݈ۑCKh ݥi Qh%EHPTLBY@݌j j.qT`ӰT.o~́Yuw1#JrW21 X|T*j[AG=sU#cZ$?Ú h6~5oTY?sG5:ĘuE?i $Li"D)^5!@&8B *Ji{)($R)raE_eQ>ҤG yfG#jiFnzS:m}>O)A0[Bڄ{n"3Jfyx0)5Y1Zc@ܲj qT[Q(tl!~t{[Fs41?kI90[ lgMͷ'Ӛ)>o{͓ޓ?_87'k7' yr/ٖ⦊$Qcx0a'oV'd*1`b;+Յ]'I1ᩀcS\@W;jybNm _E o9?R?V =Q~aFܒh.6Sh_QCq=obEp0NUO삽_ZE_ΔV*q4IBƽE?GSt&¥[x/d^ih֤oj[+|J?o)JLt)i7&f_HXm=z+G 29}T3V*H nqPok5H67<NE;Otj?f[Ă!h8v&7%Gж<}xP=((M)~Raf7}$N'#1ySq eT>[NpN+VGc`x>{V^.U֚1ұ|r{sQ銽sf=*'xJ p9jDcidˠ%tr9dʐxɥ=i)=@*nVɤUNNO=}*b%DSȩSń+R8#Mԟƙyi/s?ʡu]:ZԷ<uB?CUl:en?Jꊚ.2o=:m_,\㌜Tnү?k+M)픇1v ҕYC}hrnLȗCrj<I'֮?\:+<V, Bw"`e ;*"Hɵo͞n wn Tl=9|ХۻޖiS,E/Ԛ^1cć?SZ(m;P;YW,*|4++Y 98LFpz֚RN3[Ri\ҕBdn:]di[XWlnbER8䃎}=Jzҹ~8i3byͬmvH+1SoQZ-%w]4E)ػ>U&B(fG 2*0f(^oP_Ҙ*5TpReҢ)LW~dT\) ޵lkۍOT;ye3~v_zՅ XZ1,r}V-9ҩ[Lg"SM.g>譪ҏ,Qi$2Bdթud %o/FOv>9RIs w"@VY0e *ҝ]Iѷ4isZVc0bYI2\3UQR^Kn۷ ֛VU7iZi՘7-.Z{t_ğT=ĩ맑tF !A֯KD9$I$&.ntc.2qLOZ j˃'\VW8NWc˜5ZG&qV76r,I~nbN;Wux~; 9V x_P$4Ej(Xy[ʫfwpĶ3Un,OdEGZUB"no8Yc|AFbV~)'UڻFU%7gIw#oe$0OLj|+e'&4?ZQqƃ*"SvMMxQBfBKF?AKԆvW|V݉K/^ON.UkhQcXъZ 'O!9

!2ROҢh Ԛ8gfFo:YeӣڱyR4_?|wܦ뇚o6B*x/6:"d-,Sv|͟jy@䊊*TWsԞG>b4)_J!SM 0id,}T|˻'ʣL.1ִa6РP+ib}MvSSMge| "8h9 rJ»aW3]HgrѹF?jiytv=VxJ?f yygPHZBϜMulg̛} hSO̓ߝ8O/UTE{5 קG_G_9 iyn⺢ OY 8M&>KhR}M|Cp~TNjć晹Ս9+E8A!GݮY1</gS*>QocLy9'XM{rj&G-u8#J=k[S}Du%𳒱oa_*w $@qJ?:pU~<5L?EkR>l.  U秮懘Qd$NUޙoXǯozApn~1"3[=n⤬*хx8O`;6QVuv$~잇UˑWm~w ~ES7_W"$I?tW]fMot6>`B^lj,7(M`G Mj\2Epcb(jI_#5jGyg˰W'YA1=sUMpAo(elyҕ@U:hS׻jˊQ~d7&rh8eoT;/ j+ HPOk {(vS1/ Jظ'/Jݕ-UfZR.xMha[sȓ^L'̊O)zdwdMFGaұr#rm<Ջk7SZl3 z~)6GcWl[EDRAnri+;V&&RsWḊen5&%1SBFk(5a}+|i uc̽Sg]p5Ij֬Z1R3RP9)f;JVc"&hfT]UԳU.<)?e`?ZN@ɫR"Bz)ʕiIݗI 'l|1굕fH~C,FDO U  %hR89rR AJV=֧#ˏP f[2I65T!:o*~iZuؠ*jSUFb-I^3XFWy0ӥut*2rQsLfM.vdgҢwcM[qJqq"玵j]o3.>U{%2U:T47O04g5f&$]C**AC74yRE*SiOOM?DQJs|>F[U>U;&u?$ĸǙ <ֆ|fA?52" $TGZ1QVGDb6oenbŊpւ3QIo ϩ@M7vARv999zVNӃħsIMi ݊ L? ˑ,K'_湥lw/92hT'*Z '?ԑSXWM9xIQ䯭V'avmmc⶜T̂\/sQJp\r:TyGexIFJ)s(GBE BQÌeZFOOdَtB+c]}x'(WLí#FSt"(?x"*EdQq(o˪7I*x%J 5^q[1-q"D_2FѷcPx-TYv2۾m]YZ{xeJ9bNqv"\¨IuEX}ݍ#N*65KqxN76½6MN91Pd|֌T|{,rix5J{Xi}~8I=O|#/H1Ձ!$T Krx,:Dޡ2o*O!8zѸz7r$nm8ϽWI4=c(J썆i!*3jj{ D氜Lg4v5eqUc^s{S vAETނy޵OZH *c"5 i8JI/Rk&ɶAE3Q}ze!? U_{Dz?NZb5*zmܝ e|atKe5sY'V"e HtC-#X32}1` I즟hwg5E,}f:MBpvQO|$߭t)feR%boʷ℧ n:i|?JMc>5j-K#p@}i>aя; =XJL 1wNOʝ*(ʋ6~|)o;}=."Zx 8eX0>p@* #(PM}R%'џƫ.ةH4ۑ +U"}Rg|"X\Յx뎽zSı-IR TKI.ak!VOK LJi[_CU!ӼeQ׿R84V6m 2ݚ ǶkE Sy?!^:UޕZE֝6pSfH94Ujq]ǧKq埭VI=)#D~e5:;4,&N/t,[L[>*./(?5s3HX jٱ#g*3m";ubAY:G0Mf\V|=?İgB $sW&x~e4гjcBW0۴-"Ug[ǜ{޼Y3pFDu|NUM'֦r-;IZ MLdfP ݷ޴n#u6xIco{j*iVȄc?k&M ͼ{ݪ$H#ݧ8Olc%١OyNSSZҢː} Imt*}1Rb) I=)jo%IrJZrƮ-EFdzVWz=+^Q>i=Mo@f+~Sֱ3yfx\^տڹ NDq~;`I#l.k FO37 О^ ԷF2Sϥu$szi4Y/mn?د2 ==1m|E+0JU-m'= tNwG\gtCo9=qPOҵC)*k5V+F~鱹oZ]8S, 7__Z0 Hȗ OTTW[EFO"tY%oL|iwqqI{ Te>4.nϥ#DɱT7Jv*NAy5FJJw_q<{tғu;iIoZNG:/Ot{H2=1d_Zp\zSxE-KW(QW& 8 hi0ɨ0Q?u1P+*PLw}9L6Tb&_5ۖ.EYn^B|dpWgj,AAL_)3rSԘ l^%R\⧶@r3T,+"`?*(P~U{ӊ;4ڣw~^=dM.A?Q]ͽc%GsW0V5@{^WzS9''ҀꭃM_*|bhpa+߁mRhdS$qa,[nfI&U8zSdס5E`WD-znmFNk35ا{έ:^wD҅.QnTֹbmZ ]'Ddibz5vkQ{N9ch98k=Ezл@4ZEL)z PNV6)Ors`g ^ĀM5NG5OR< :0IK'LpGIflauH qLaT+剟'} ~Rpy*T5~R8@Gq&i }].;bf>1UB0ZXǚ:ErgTy/ tM}j]s)# t?ʓ~VYCrTk $ĜouM(cE~IǎQ&_%$9S+ZBGcڧ660)<di ]7k2bZZ}bRŽJ<\jV_“MrJ~5m=C]BCְi_CRb2?*m-'$gэsY9@&E'>XO-1Mb,TmHAbPM=Yb)fDQ'CX4d`#; 724ċy#qR f8&gVȓn|uEH NMi61S luKSYk=k)N5F h2"b|y0"Ot]ʜիx"bdVn:lnK. *&s:S<晴Rv;_ri9UC)1s֘m_/< ap8:|eWgV0XܬG`N%2ȄNE0z梹;`n[(h=)~T py& <.rwJW>fe-j^v*/C5 &1V؂Z3֞cZ}<4>JjŒ/OST6,+2˂UTOmT }ÊpgB?&uwCmHH*]VLD5'_Z̿$S,3z)\IW=)V6l1ʂGCMf*pVH>b;kLp ZРs\ua#Tdh逢^:}k#Lc׌FݭԅO#8Ê>Cp~.}3`5!5)''=){?+Z6ҝ斚sEfT#s>thϼR2$ sՏ!_sT!n_C$^l2F /:,;"w-d*?s7DrsmA j'1P}jv TT<#ǒQ[)rM܍o,q+'^--yRlh_UbKjLSԷE0w^3Qc;T2eBsjb#W51갨jC y.ךmwJ(!'CrU3I[ګc<3qv6Wa« L gEڝ}ڪ'kKfn+Sv*Jdh>ҮL˵3TZn]YdjL) Ce͸j*LwsP$1O~nE'UU'oZR)h58p,y7sR3ՎgGxLmfI_cu "cW},[ՓFN*ĆbR Ytn1*Mޥ})v"u/K1U 9&.^B"mysOz.{og.0~uƘvH" 5Q#Rި:9cJBU bE,Ƞw)1dJoi}5<k~sxGĐ*.Iɮ9TJehAdI`8=><7o]%8 /lV^5qL۹KV giY% MHِ_3oaMH#ҟ9n5Mu; ̦Y@O˝*d*C% k6feGLkW%vjJ %R5K[y$hˢc.>eNOֲs4L䚈W֪Iύ2x"?,4a:Ky&b4RixUHOZt9 7 ([S&neT/eɨy&rvסOS 0iTaxj'xG"'j'*cرyr9#zț$[ 1ՅTr@-ުEtF:S_3^hr"ӖRĢ˹Xz帴QI~V1qe/] ơ~] *x-퍊nl' +zMyYty'Q_ML\K{<ۦ+ FQ=v"q-rƱN: 栻&;CFNW^O)4$nu *Am&2Woֲo+6`vVΦi}>% $a=Ahc8\ک#W.4%?3R*vMXKY#{)R0SH/SP*A7Xwqާћ֑-*'F“N [_SQjhA~NK5Q*j#4˜%)14O#%:G(ж龔_ە?5'fhYϾ6~-O2r=6iBTn0(ζo)>H9|ݓwԄR |iU'CK QFtbيc$U $Q(YץhFOZ:<_:*Z[$SҬGUoI>L/]vʲ1͋u'R#ƪ3*.y+/5l$럼?y:=9CTƐC0в;BvcYXeI]>TbP2PV{B^ΥΞ)+*9mͼ4j3Ӛjʧ^R9WMhH8q S>8O֍NRT:OJfhR=kE>x]nlE'(^;xvke;Q4HQM3,dgҺ`rm rpZ;qwFS<6}֥K޸tuݾdfҤO8=(*f>%vac1 UY6#GOW\prOZuHұfc"6sֵϒ\чJ[\Vf#rLdaqϮJeOsYi|QPq;]}inIf8sTFj(DZڳzVQejU=+.e̷0E5̷E7 ]sF 2TZ%[\DIcܫ_jڷB͂qVfx%z~ڮIvZt/2g]Z :6%z:i&.KHP{V=99KKx&܅'ҳ9ڽOJ &뾽U.Q!RՕ7s4KS-&C5yVU`MzWQz!FҬCt0 8Zut֭$݊.O#(x#޳a{WYhi[&0zk* ,ʗ/okbc0񜩪7EP$* wvQ߇lAj"_3/LZ܍D *}+H Vf15nX|OAںKY$ +7f~U?!b5l_TT}E~yώgQEY 2f,Š(9ԵMQK\f(SjHݗqNiCM[F𠯱SPgڥII_$v=]hG>S71M{>Z2`qb)P݀my௨^I=i~<zPiSi)3VHM("(;>O=4b0\p8vEgޓr/ށ䉜3N~ 5j7 Fkzxjbi%F⃓W" oGOI>5gwKVu z˞k{XI$ H6~5Ji&Ԫƚa$>KƦ-jcl?4Civ|:|=6dOZ}f)k!c08U֧6 pI2ڪ(mD?JqZۤQs0Ek͕G(ߕr1Ȥ9nqR4ShzT;\zI"ȧmoSNT曔?JpK 4cϧr(q<ӗjŌi|f.f뾧e\'MeA59z[_B&Ni4ć*WITgq8y(<=Hsc*O칇nh62*oDRD HAO[hSj@)PO}0R.*T vITcmUZٍJ"ei L.WPɨ5DۺG1)W%!B3I Eaw>W ċӽ)`*?_ҍL㕬BqOh<7 #v?_̌;z )?V9ZEԆ>fyO4?tcO;nHLeeCV$ϢRE; Y2zR>^mlvkNM!Hog{v\Iئdc;q_Ni3|(7eQn3XƜ B8%7u?¾rt^4[B"pbKݣΕG'vXEf=5%ʹ+L3LrF8m~^sTԒy.OƵ;Py3Yʔ$D ngM8 t|J̼~/k:''cò^ 5-6sG >X3Ϧxk/Q5>|(I6-+OA<("e jVEc2Ez 2cO·K 2Dv7iJcjUcEHTm?QT㻳xCX-epv. ӐI4]A£Ϗӫ/yRN5|QWo8+TG35+(﬚ :Os: >W_,lO_Ă+ĚHE>[t4"5jE[{DЌGZVftaF9#@sH$јߡ+mu6=ǥu v$qA9횺.U+% =64jrBҢFѱU&R#j̊:QҘsRVPy4?+'nٰ``{Ub rq֯GEMJZ-=LV!@ yܽ;*ϡOE;rVpp(G3$OE`zSѩWNFx=2HВV5=4B37InKZ+;JG&5*YN=BISrEJL|W^+;ơĞGҷ75zf`Ux>m<cYyؘ`M1"D##rUqv6}¢Rde*DžS( 1M) FJiKգ')mT?VE\"or)`G4: }6]1R(n6Ww=uDNNmE>T!2k'PO%sǹ7~L,tx71{X޳1OhJ-M1osT jB3ʃ4)>3O 2Mn64'ɤ2ӟqZ+F"xjDӟ iF~hw2U$`Q5XUFO,i/{$Fi%S"sOE3 1VYuHO\ⱊJ(>xJ{ʼnʥгLNݑ]Ƃ7 =N}qu8.' s)SSH_Sq|b_D@?п0ڭϨx;vЃ5)u~+'5OL?glVp,$_^M#goC"_`OZz0Ɠԗk[XˏT4s$QTisOۚe~U:Z +XSY$S)JlN2F=*x8Ԟ,ĂNsJYHvIKEzØ(bzФNiRVb[Yítlj!2VsOP4(+^ksWzc= 9եCesNT'Rmbt8"Īʊ_w#Ҥ#*=)!Ӷ nx%v{Эp51@Сғf4 +ֆGjpS+S[Zeozֺ0Sg^ ޑ_q*Ӓ=*Jewm.MZ\֌GZ(5ޏKD81)N۹z1M]xڜ!{Ob5ѡ)+c3Z8Rk6I{V|ҰPٳK}**5?t.sa;{ ;T֌!e4ڐ˃Jwc+>F5 ~u"vQ,05ˈc^/x1$g`E~Y>?_η&ȶc&$z5ͤGw+5R>\LԥFN1R:8,Yڃy]`ls=R<TR QgTiR=묬0;q.Ť-wk{s&=d'o[pOJ|:t7{GZf~42ief;FiœF[hl=8?wlN$ uUepi^ehVnW^xZ/B~ QC##gҝk7HTC"]FR6̣ӳT;l;TS@vOGzQa^3o+g"m"#s~ҫܻ="eɏԨvQ5 Pʵ,:lKyg-[ҏ=iJLwI %}8 FwzЌܬQYF5$33FÓV>k> ƪ^1Zcr.lXֱhhÐzY4W%atm 85 swr3^IZ\ ^H%1[e椆ݜbOgK~VEӦYʲR^6.mP*9D2fOs5O1nvj|iV8Naڣ|y1OBg=daW: jΈn!v4kJudzTv6UtWzƌW_ef=MZf('dۯOsYbj8S*8NZ&4=_{ZsJD쨈?+V'v#w=>mk@$[!My8 X-Ӧ#Sa4<=?MS*\|Ϟ;W5')I[H1 Q8MrHTpf0_-fby&{rSmBXr>Y4qU7ԧUH]s[kr3$I_* -TNe%՜ج$ ԒKut&[&B-"ːۚe6BwiIc?jzU-Kr› 8ɠ% G7`U:kv'ʣ'V@شXZI ڶʱ|Ub)**y^+ӥt}<<ꌑit(vt{֭ivJ̼>-fG8<Ӽb_gnBOwΏH:1<q );3NJB=S*&5?8'=pqkimtKD]>ZWrkdթ{6_3@(nOSO [¥Jυ+j:n΅Sg󭾫%V1[iq:c)ObQ8OQdoUmzW8.%S/ڥCO ;=E,4ey<:cUYmJ.T烚fȕFTv*9)s+V8*GT bRʬSq<#Jym{*xYٹojlm#5|A ki?5yVm\eSG}".[;sLr@*O5Zs=9ddHVJ-9E-?j˸1n_Em=) 4fcg@. R.H6NsR,NvN)9(y)E,("=Z$wrP木0Qm4"iJ5V#<6;S *}rZenk?¢涭l>+i0a L;'94j;w LOZ6Gt'4ne'`˚aa<i}fB _q'= ^ݎ ͜*&Nqc$ֿ<_?A&Y$_Yu(mS~ZC X䜌u49⡍c1f6=e48>>V>O>v'z;*O#NJ9[6tq5}WcGDZՉFɮ wᚌef2B7VéU2HDgiHؗFhI '4T^i]9h@&GX¯>ÊR*dž>8WXS,Іңf })~ŨʁU&e~xPQJ?4{ ;&!ZKs"|T J}}N"2hFU2NiHe5bE&Ҍ{~ +?j%nS+mZnhh%^6A5RtlsNnjYxlR7NmpJב2z`Icu<71Q(Þ𫒻~#13n*E69eiS2*JtӼ7 psϽ_rK& Bz:VѬ֠@o|WZM7QquwC PTqȪ[v ofnY}kjMUdXTO5AP>QxAx&fcvyqN+ HٝxXH( FS[sM(m8UB.#Q>bS H94SVFvhښ2ۚO46Zֳ+֬'b@5 #<9ѕ6#w2Rױg2}U=);G˜p) jmG]I `w.G F)OL9 rNV [>ԭ(p|* InW4=_A D :P,^hܫe8k5uNڲMs?UUvJy}/.0)2=9>8(47+ DQE=3jd5:Ԋx]T6QE'ҔSA}tl( Nɦ=x樫QK3A!G4IfŠ)}sOY 1Z?-JXGcui}+h?͡N"9C#֝|*zUeqV#3WjCoOELZ,}IJY'+؞kxuпa#4WAj:!Z CtRuKR%>Tlr$QJ188vRr"33W of -/κe5Qzo#(5Z9?3AJbN季lbۃXyQx~ Hޡ@|^G={T'9UTrYSQKʑZF qvدi5`B*SHI9?NFBr}j#?֚t=HpI)U[%dN}V,.8*ci?~i?[UfcS~4{iu[rV<ކW*g?W$~+ڳ?#n|ZKƑ:FRt(JvFWy–d|Pm|iB!9n\&N(Ҋ;9D^yޓ9 NS6Z< S;EnAq֭ pVr=ZDŽE,Z|!c]vmm $ZB9aL()4ԜzW"GKCd!jRGBl~4*N;RW9p)J fhI 6 R]b?~"k˭ĢwtYk3SB]\?"{s PdAn#÷.y9I 4M(>fYv d'NA)66*͝xZ-`yO5m9J}nrV-ȼ"/T -K$J|'(4h͘KonPjV֗+Q-̲2vV鎝1S&ޤ}vg8(IzRҚ̡NsMvC<)QW!vSLφ*ޜF;֢KE2E˸4͑&~^z pw+9Ku@ЭIxy}hYS?y:t?6EǾi\fg猜Q0 u,3WSi2Ÿĩ-M.v:/ԡEW*=*0ђ1YkVQlsΕ~ZRW՚FՐ+q\cTzOqRD{vT͞Ϳ9S/+QȘ>&ImdC[]:AR>ׁUyբR2Q[Mf͍\ET˹}IkޫYeᕡAp6֚zCuaizK/U*X1'UMy ~SZ$ I%OltKZHydQұ.29Rˆ&ȧt Φ{s+. HkmIܜ~[?Ґ*=;ԩ *QN 47\DZ[)!+}jҴnxH5c])Piq{zVn&pffDcx5v)f`1ȫE4ջyn>\Ӳr(HmϯZ\к5!ya٪W,аCXuVsƖ_lh-fDp?0zSw5FŽ*(!9XOBm tzj>!\ޫpBs#mcP"{-Oyd79z)I^} ۣg^Iyڇj/K(8zIi.l>Aj R\x9M}kSH1f#ִH#Ғ1ԞҥqPhӍ8(GdjwL69a[[3QqRIH)֒5JNi3Jx^jZjssQ&KR1'V-K(DlqT+fܚg5'ƤeC[q?(u mT׎迺O|nrCDݎ)Z(5I5rG8?Zo |Î*\%ؙth8?^taJ IOҀ7n9—/:b9h_*#$yNK)\(6cX[Iցswh <b_ʑ!dR5ʆ ے↴v T|]Rѓ{u i1yԢ1$vk]G_} u>a䍦 tXڳ3rs 9cRo~ <,(' .; `oٰg֭oB:vPj!QK?Zgcwڠ!~q֤ sm5HpAa#_vNWr܋ɔp!(kidʊO@V !?)֜qYI E F7ݭ"^j9{Vj725ʟfWeʆ%vtlӚ>JFdꬡR0zvYI;sWG gME%$3N|I;F X(8H4D N۞>ih#Vazt?.:юH(ؚ}Mtp*  >JmotPb_5Kv<\r(Q'$:R>Ii%D5v/*$v4ޞtK^Ԁz*&Sp@ǩ<.юp qsm';sr~ZlA'hMFG;sӚd.sO`*=CUJH{fU*.Z䢏S WAcF=]l=*8mձnI=>jJ:i=87JO~TKuQ5mƒ&9VTyf.wB@Pj΀ Ul'Z!=4Ts?nEF+m&S1Դt*ۀzs#*H튰㷕>}w}TnUj=F2+i8 /v^iTR#i;wO&+FR0ALhx]PjE]shnh_^r2[b|QPjV+?Fm ?doO+Юs%?ӟԒ,9nSO{ITCZq=ʭ{l⼯ ,ɮ"{XmB"qzvkTFeJRg+-"-w3WGYC$JѨhr3؏mIWim?s8IꊶN[jG!jimQj 5>9TL~R:TƉ\wO<qFt)qU㶎9VE8*sS+4 `N.Qب7E< AO9C+K<ʁ}ٻsD\3Ymmyړk)"KdȔd\,A6ûh F~uviNII%GPޢHS/#= ? VSqS,2B tv*[5̑t3/+PBQ1ޝՊ1!R 4B;j#|jJw? ۓSg=+;j͡0#bmm677`TnW%O]Y~ԟv6s޵:~?QR)ÙRiÙ|RuI@p x~k޷*Č[=x]ntfy|cR% mRy6\_Ο;>gܙ, 0,y*3u:=nao꿘~=魧B<ՠx \ѽ>q|ϸbզHI>{TSĶZ/ԚO6,ˏsTΗw4ӥI.^]+nDLm*6q'VS!JC Ӟ544ҢZ[G ޏi>.asA?eQTg?/>4X[Qoo9j9WrJ3)J:*&ݫ2۞حӟjƦ5u\d&_Ƕr{җ4=z/d<8*&zfDHҥ*O]4ÌH>桸M˻Z|Rv7DJ7C>^Oj}R۞94@%ђ:8j VȬ+s=,4W_2zxl.vT;2};բH}hM/z ]'G##ݻ9!E"Jŗ+9l {U6]Jg9] Ք+~Pq^^&$kpn+E=85r&G^7Ϩ+ޛ%9RQ 瞙4"y47 @;֧HN7)@8S8Qޙ&FF)ephn'.>l("΃5uwaI84ll_zsIUw3JҘ.9 M{ӄ('icVL 8h<5ka$_~ib NPᪿ.}+OaSM~U?yjD;G-8T(׹8NO+\r6VRj7ܡCUxQU6/\S8T#󐂲R&^•&k!5V槎B]ZG\0s̊+y#qVӬH#g*F>Dc[K(_یlLGkͣw9yј*:=qP{]?XQO! ҿCXe+M2'khHul(>0 bEۄ\u phvid)@}cLh?k;BT-#&AL{1Һ^4,o D!č,90}?PvbX2yy=~+[$)Xё:eOɦ*;z֫j-ZÝ0!uϿzoG?NKiW>+&MmdO-IH}qTӻCHm*co.ѹ9JAPzXĚ\Z}+[G||W@4=?*vm(?qƁ+Viv8J}isA68lmE*5=I4r'1~i pѺejq.> o4\ L6Y[a##v?HD4ﶗU9P~i"b7q ӀPYw(sV8sg?c7f}/1DPM'э;̉(ZbV[飇tϦk:}V; ]K*"{$gi~aڇyvx|5ڜw>_Ȁ>A wH}^^$thޗ;{Fihaʅ&Z4?EknF+n_rUCp\:ly+?tz;H.KpOv"YoE!=)ԙڸ8RmnۼWnGݫjir}iq֕rzg zJP"l̰s5DEוӯaYO)1hu3Mu5D߷Yw. XQ%㗐sVbvgq=)9B1TTvv )_4H*Jc.{P`3Be*kV#ʭUMyԩBGݤ!zRվ\jMO>cPXsW#/AKּv<竻jEP zwDF; 8 1Js׏ 98@۶7+uD[r3MOzW}N) (^S*)9ԗ,i:5gf'Q*'RVBĢFˆkQ^Yo".Fy`"fߘ>4[qՕV8ֽk^[q?{RI&.ݫ*O:L}ӖWU[{f_Q'+9F7zJSV\{SvSQM*C.{bne4}QՍXdKϞJe/I>Cc-L˒`oo&<z:lԟٳgO50q#+H4Q%1׵(7A&aQPxjq֔XMiUm IÑ4o<*RFߚ7\8_`<뿕+j)há5ͭ5n|%QI8u(E-$[yTmEm#++޹Ֆͦ8WJh9)Z]8zzQ+QیjRG,a) 5ȮVbe ӱVz֛/xU}~g*好J_7e?Tq©˞~3r;m^Mh {fɮiϽTӭ1N0Ȭ=;+5\WVe/z-5VX,֥{q?.t}iŝ_wwC}pyB po6*}/ "C*ƺ'/Aҳ-u 0F?-\[#]Nji"+|u@`xO #XWm|ݩn|a⢺# <80=c?ΞŁGTe, ? K?_^Jܫʿ2hliWdاI4G]q2:Fwo)O[ѬqO'x 1zUe\AYW#T+n#v=Tҡ UB*kT[as$ 6vIzV?#yUj!QOfˬ6YQH#-f^3[H oWZ#$**y$[[ؘ`~Y~nXpvZwds鏕k5j֏&ogU <(ǖ?7Ѵ9v}uѪ 9I$IP=)Mx^zc;2B BQBOn~^Y<QNcR=?vd:1.v;?/OZtVE۽|ۉ<$9q]-~ZsҺ#yJ.ԛ2z1UIE+>9${B ?̄ctsNi'|SISq'O= &l$SZR,S$╷2?G3Oܠe?P)=!&ITO5'O}ơbTDz1Uϓ>§"y1!d3/F5tFt^ShU%֐i9ׁѦsBMftߝt?h>[4æHmE3t˚~ۂGӭ7d,վM#ixdckq(6_sڬgk:L }UEK;q$R?׎14՛z\.ISeznW<;"6ݯT\|^Ooފ@ݥY6u0g Nmdc4lL??׶??i> }O44+F(2@ j|FzO,`/skk ] k7{# ՑʚN<@R: dƥӗb'X.=hS9tgeG twҔm=4 5Y+ gVrt+(R?V'٧&AVOo`ݷ2隆52qҪڙnjH⋏VBo%.\rWʳ#iМe#f7>Vȫow8+ ѡr翳<@?첏]aw9yq߿E9>]OK뼓VJnA҅]>1TiEttk * ۟/MXC@-ӹGmıWcl^:)m[x9T_2(='旷pxVehm^O ^HĤ_)W SU;uR)JgeU^L޹H^)Z𣾯S:KM`"n൉E5X[jYhDxyO(j{kU;qE%eQekeW=V#osM/a rr7k%҇rk2s}GJ)]>w<vS^'NNOE9ɦħ8G]gEu`OOZ"ͽ=-|uY甞\g'$);cɨ'c֝xElS!.|ʡy9qqze*?Oߏ p.};<}؊InֿYmOƱ}M9]xc֢J?d]'w?!z瞔Ǝ &ArTd&VYg?h zC1G"~C;@.>KǣSuTt:4廙&O o\z\;[~dm1ÜvgG')6Ɏ`o Y';uc.b3HtɀC\vFZ"숔w<Ԭnґs2=1PT^d@?ӿUo4ڶ5H5n:hJ&ߗjuR1H;}ҖCҏ|R\=gֹ zQ<wTӘp( p8Yc7D3Pim- Gp*R-H5wqHTN&x W1ǡ Ƕ(X.hG'SAZNbQ<{nZfO5N-0WaLu~?.fk|pgNp2 !8!pp6'4͡[?*u,v)v)\'҅#Lڗ"VV\cR$;MLdiR$ j)q=k S+e1`'^kњS̽I'X NVnacujs6?LfsI^]?XqI>~vҌ6ozUTr+*eVu OZpfUNxF璸(b#E)⡳bȾe׽yZlS . SV'ݫߛoFjLӀzP"R8ԞP'8#$j9S(k*\ KWnqUJnњҟB?(9RA,osWZ5 -mvQ?+=iX"dZ%ژP^}DCpr:R4`q78CKpiSШb%xr*X$*JyJ^X!iSÊ_*Oʴ,'lezVb^+XBN.'Tu0@su?@^x*Ee@W|R#Bqycs4*9?pWDq*AQG֥Xv)srw_zz[hqO6 y\gbkh"۟-*A_j)\qRQa)ya&ac/ ݓ~UΐJ?-t?gZ֏F#ZoGގ$gqQ =w@''k~z<)95hzHsY_Zi;@P5ze\|m೅)m"8C0'iVcݫ K[_a((oNhpߔ l;r E}*\}pkq %m:w֟!_[c؜w!#"ay> $#SǭmfFzO0Y7{7%s?ܠRac*6PC40VeJJ*O8JXKU9i/քmXHWUDT[g|^N- ]35͒sn'k[4gɗ*H ZankDDg"n\㎦켆4}M0wV.%۟U6kfCS/Iw$K@p3SxZ.~_'9g4\cbӳ(y.UeyN\9s7Eȟ;~U3v'҄|9*@ޕ~R&2ƇCԎѷ*~G#`ST3Ƽ(XAbiSƥ=*E/TP_/*s9W#޳2By?N(~]H9p}iְ[r5w?OWK}8HӐG=9,S+;rq;'+ey'jgm?JzycSYyԕҩncVT'ĔKD|*z$qO]B ' +$sa+JG?)${eq;+Sy{%2ÏP- {~ Frǿ)>XB4'L7jl,IΛ9=S!{Ԍ"YFǚF%Xmz40Sԡ%wtێԋ<:կ*8 `S:uQG4T &R<3HJVu^֑FN+R3?ʤvΠZK8_ʼy9yK˽B79?vnoF>!XHs;){QZ;SNU+ץFIJzO,?\ZeImnӷַ!XcP_ݎ&"/ a! FI辴${/Mgmϝ.KӭHqV8+M\)s\Hv-sG\<.9W&G@_;zӎsڍʿ.dgӽ)z^)8T.HׯJnTaNX9+GiXw(u]kFL nfGLy.|)GkTglIՕC媁 $ɦi1P}kJCӊt@ })sOLb[U9б'YԩQ3R4v)^8✫ UǃE,+yǂ{Rig0UOJX"R>I>gs96:(MB$U/%(9=rWi84 R'ITFyi;ץNyQSq制ZnTǹ?/9=)1$s' K;QfFڽj۶(X*bHv-ixh6TGV]P/U+ΩZWK<|: Iq-mK>V#\ο*/LVǜ>b# 6 Y!?s'G>_gf7cK$z=84U>⛌1T"^_KGY׊C3)4qzq9;v ]\/SM}[Ba*Cw Fj\\. iNpWh)Y—~E*O F*!sc>+XO^RNA0ȧE"-)4aS zb'੮n=iz&^w&bHorf/p):/Ձڨ /uIcQϟ] ==irGz`?ѴЬfy^sV\JV\[a;RѥA#{n.?SZ~~cK~?JeӶ8*.Qj*nVH(P=3]-*Q2 44zPh ƗF8UU98.3KK1Gz()LQJi3k9\~5 -4*acXɘI rB& I+pRkQ{A5!;vґy$甮yp?Z,Ny6Iǵ ÞwNcZҰ&mc{"põ8-ʪةH6w;]^Sm^  EN^6rHMAРjB{Ryhx*(,0hЖT inWI C)N[eW"4'Y5lale>;ӺR(hH152[Eϭ!|-)anOY6u_΀$Q1_dBpJ?Td*Nfy2?C P.sS)#9 @9ZN*i$ϸR#_ΑJ:n9;C$'JJ 1Q47#>zIѿy"2pj Hвm!qHR/58 Һ!+ʹob_Qg!*WPr(ҝFnJGVcހI W7:rn"jjK"zK^dlǽ&Ik>>\TOV{lniZfpVn%")2j IWKq]sk.>j1O"UOȄHRiWo+ni:s4Q; ;pJaHy* oƛ!o"7VqF2ah4}^aV .Oz:U3^W[P˷XڒqTl*] *)q[ 1TʲO;nXMֶN(dY 6FRaSA/O(}G@|VfTPplUA=T:F6qG O~R)eSA32 J^rv%{εq8/~Ւ%Lxi{)7J] -qq*m>2^>{m5"qY5=ecJܕrr k>Y,1)Mm&ћ!8ɦ3ɷݴ܊gxC4˫in3"V%FZuEwKd*WiV\7#$Ghњɵ֨TJzn&|FZHr*fQVN&:W(Iy$؃Os,Oj>t9RE_sьHR(ҍҀۨ 2iѨLf =)ıCU#j'9L2zL.e#+6t6{[kP+9,sk34gER׫Fj=3禤(Ubj18+yu5QN5qMͼi=zr^qmBdԿ/B o;"T>\ҖNO ~mSun!\}c51JX 帇i;ך\ N:aSrzȘEVOHqSQ r'Τ^Ѭi 'r?iD/5O /'lXЩKIw7BNi<\ Fs΃$}ƹ1F4<$,X"gHn-HU˜s5U\] $޴-r\Ϙǝ?ZM!?K Lo1I OΠܥ|TLH]Bʄ3!+?;2|Լ$Tܸn"'cϦjPcCE8l?WL*_Η_ιJ}_>2>TgCЧ)dޮ&\X_R\JYs$~no֬H1iڹIk[xb'\SX_H-U۟_N)Fm+ W(v+kTϖ=5ܦwu*8N]}5;Xۢ}@)!EƱixxw\S _]Jru'ovҍ(LT#h(ۗTTTd'g4)ƪoI)~cJfr'qPWVr񊏭RN̏ҽ'K&e@G?¹Mv@K}nc=p N>晶}1ˊU'<³ν֣m2u8KKgҀ~_LH2ȟʪFT[Z~wXQI\s**ᭈ:D=]F[ܤKԞEgGʹ^["@zH/&H?^фd-ƫ[QO''T[N 'rC~14z)+GCt"G V-VR~Lq28W),Gii7P?)9NU^r=hN+B5"9<߅kV^gGnoZ4WX#$MpķHl㌯۱ĆY cl!}㊸#ʢTq1TTDDځp;+I\4Εm~3`qLoj:t8dccEb6U T2t28~+M$-æ}6'4Z:js֛0++e9857(1T ZgM'ocrsG %]/^E*OFG 6~hӦzxcjӜ8>\mڛkL\旧#M w>*ҙ1?`Vɿ)1 '"rGZEݑdjM 9 zӶ}zzrn o" DL:mh92qS9VV](NYTuFhY(iVdbyIpjr/Ծȧz5Wʥ[jZBIQNbђR3'4GžHѳ*sN;ʇ7QIRmx4эQ)qE; 1p8b(=␰^SK* F[QQ5dRJ䶢7l}) FW!$u4Q֕~u,xS+Ug,3<=9%jZ6Ezُ4g<R)sץEsɶdS֫8F9I@'RnAU&vRjCnj~P8o"O.vbn~fEX$ކ$kʼgjZ>i &^ ~ '(i𔍤׀j†zEUsz NUwzB Pk[CH˞Nr}.zQuD$kr5p+I|3Sj{Zl}HܢsKxaڹ]> $\NJ5Y@␒Si4Z?/QA{Ruq+ [)R1׵&veXzIEK 6q\9o4COn]bHZ-ɶU+7&J(U&0~Oʌ)pqE>/"gm8Zʴ)e?ZdeG~rWmT.2s[V *N>"TS2sҼ#ĂEs!5Hl"1ڠ?)<1VHќm~ 2dQFGKNߺJw,lt.^iFJ0d^ #dȳj!vIcIcRnjAOݠӏAQf E0Nn:mcJD3_;~uSǨΧ֚H6W&3,n!H"B0`8é ٭+eA_d汒HʲIcֺlRsj±6Tu%{Vr/vd5Ssg!]kJ9UUϥ?RrIfhJZw_—5pҿ5ҟ(#Ҡۏ֍zTPb9ƀ̿)&)4㊅IƯ䰱a[xU6V╃n-g*q(F_nW(n>[#vހ:.˒H։R`~*]\M}riAAbMYcP*inY _Ⱦ=%dnth!oVOOJ&O앀R8)@TcgZ*Yy^kkxHŨ jPM/oq)g'暈^s֯W0Jl1¹CiBzU0˵Tb9<&RTGxZzd*kgdIʡQ>}*E;-SsSF$AvJEHrw\.cƠ9=9V~yMhk ʙYΫnhλh;I;W9b;fHA'kH?Uo$7fsIt#NN GIXd9zjte?Zk,=bk.p%qX*9Ӛ̈́o\X!IP}q{K\T3R F 33:eW2*q( T8*ⓜ@x*]?-y髵n)Sfn+T0HJմX#E O'4˷^OQJ-$Dz}O"esjo.Ua\֕rD\8BRRprͅZ]:Bx*E'0Iӌb]br{⬪}BI)KpJIY!2GCOtUB(vAZy RbE^)|Bqro!EbsP}'|Pg.J}6[CR+EJWC'ι5wg!k[j(Iogb'׵_qJ~#U߻?<)Co8jy-SY dvąotrRRac/J%w,8k65H޹(,дr28J"WGĔcqzS`bA*yV\擺F:ѴӰ>Vru$HSv'qQc{i & eJ{Am**FTghՌOz2`HV5q*[O#ifjҐI!ГVA^G֡ԟqF찑L,rbtr"@-=iNfz)"ϸ޼1 Ӯ4&q20w 4qŸjzktukOOʺvDGqIh3Z)99R^sα_}1C68EJܥܓ.2=wSsb֫ʯʿ- ~}*B)HpwJ\柷X܃lJsfп[{Y Idz;VǗ—"N[\џN^0ԦQ}]$hېpsXJi6p9+;B9m׆[Eƭ6UsҚ9N6:V+$ѓ֚W.|'FG 'PI,kr{(?$\_Jf,ēk*8iOYh4¹WҨ)/{R3Ll?խ4CcZC RB>r4 ?/ҋ87(}-$J~)sAYMGxs!57'tJ,kY[3 em;v4渀}Enł4_qNXztA9>p~Z$&ٗ_Se ck99ܜvT^w])<ߝ 'qWPi$O2)< MgB~ufAmNn42)bE=*&?gqi$ycN̞U94⃎GU.,mBx1g5~N;)8FmA.zzjmg*HqtddG+8 ~)?jrH<*YeZVqXH6өXc43?)SL0Jyo9OZRq"gJn90KRK`) 8c@tz•NF{P)LS"JA)V"9G \y|aO)B򋟥3L`Һ>%NIEPcAd>VOd5dc1#R`H~\˟-L+q%5B`P ƓN~VԗY { IG<Xږm`FFzϷdpZзb@qO(z}oHAD/Չ~-HnqW6p GBE=I9n`L悿'Nk59֜59s/Pt*tjy$yT;jTN` k'IOm 4OcQk_?0@NH4L=Z JMTDaO {/*By޸ I EҢAVV2I^{Rm# ܰiN#P 'Bn"Uu>@iߵHnxi#_k!M0A#D%mMΣ=jm33ke/mi^Kg<+b{RcMV_6JׄlN^Khϸ+9𬫈p`M"GS!Ƥ (_o;*r?*JSh^:wM? FSvSޏ篵65zs|}iʬWwJ%p>Gnj9ID'vqV6+kO(\EsR3vp߱K^Uъ}[Pxܬi VV$Tېi)GZ:k=Dxz_7+۽8`xuhKXɕqz5>WpJ(I @'ɐzbFN6J]H{v)'Ҝq_棔"z9Uע՟,5ɺDǭem_){]Mw!yj pԽ4c GSL,nheF64F\H'$Kڐ(?JGuJc!* JHUs@t k*̒*+XFz Oc~Zb.vfHhTg'K$ 捠899Fryr )% җNh#Zj3LajIb5+~?p0r~ƸHVb&fI8U;!$&ŧXj H3y ue=~tl)njqIEi]F:M\MF#yM; Hz,z)|gp5 EQiR4$S?!^4#)^J; #)^IU}IBrO^fi#uKXeEIZ '5Q5(zN]B?W,v=uO-”?>Oxڿvmy q4i WR(5 \.O v?^3/R]ۊM+ذq^(NMWZɟ kL}?R$Nvn*ÃQq+ܕ6U.(ikrh7ȏE?.sBʝK/2c GQ[sbOʛps~)>9(H 5T~r\}iiI<ćb1F6IWCM'!'b~tNWyJ9ϥi­5a_;{sVN+[}t槆8;RP9.@?w㍴vB8RlBǓ;ѳ51\qDsYZ+޵ 9YLEm[7j5݃۱`%zv} ; x<{UKf1<W9D;OJ)s'QEvn͋ґN#n9 Rm2|?XR\\/Nˍ(?%ϑv$Tn:ګ^wV4o91MV=s^}FVjUT֕_wjd6(Z~KQb2[t+]JM OQM?fW yYTv49Ғ,8<*a{VvKjk gO_r7YJuH-/e?bS-Jp(h_s;UT`ȧ eb#kEHJu8)S1K'N[ԇ נL{۷PydaOD6i+Q҄/'%\dx A*O뚦WOXvʸQךQx݃O(dpۓRTU#s!]g9;oޟxUQuIXS99O1_ gsVvyZEڠ/#)j˦8d\'B?݆lOcQ6BvVN؏v*>POZE-RM@i9) *ªJ]@T ^$"l1Sn˓|TkYNNu H=waiRLmHGiehCݰ#tc?ΐ[IO4q=NerRxIAM4ZBс=1bZ$Ԃkre_nmwHFma?M$ɏJ((MBl?zx")MŹ#l9&@ȇun)|a~MgҐ)+1SDDS Vݓj3'֡7Ok2kv]tKM^c)ߵbf6*G"RZ UEO*+ש<:lzUHqWEt۳J@閧o(iBg#i1~L֊jkWZCɤԟBV-n? U02)ZWn~Jwq+'L-8r|=S}cQgûɭxCFF pkgi`.g4kשN>.nILсjv0qN+Ԟ}L&$>4ݭ=})2^kdjя/.zU܇ݍ\zC}5*hjaڐ-/ҷ:m gvH#R714ZJ^S֥c-nY cjk%C܆bcr\Sdʌ#6ͻћ[<.zT6V) j9WڌmE&8 [6;y.gcքHD@A~\}JpQOLnC'=E5랔zmn ]Rci{) 7lBTUu{ L-]*R R*"jvFK=*;ǕeGI9sԑV5 #bI$J+ԣBz(FR#+y$?ujV8{Rd>LEqRAVj*A]ǽ/>])ʑciRI;N =p:5on1^]\CH=|Cc!'"beb[֋x +ִUDc1RGi1JhXCP&Hq֚* iT"'ړC<擗(ri\ӚNJλ0[<)JzV51N梻iXBkמz\'3Ky Xx' &?Ix 2S=Gi{RQ^(X'ͷ=Ңb6'42iUK2M[M2w\XSv2Z'_8\Rn֢Ii*IJgM^l.3R}LBOrpKԪ}vJT/" 8_t5<:(3I9{Z]НJ\I I,M3 D^5^IM&p:›@3CHm&}`?շJ_IU€G4c8&8:-UqTu+q)\}JS(oʐO芌h}RfhTq l(Gu4*I8*>93PtT ʗƕ b)m9DUPZ ܧ&9c+ v?q }pFOq8fAb>*|nku\~V'n)pOJO O%`imadݻ|8Nn['M'Ҝ`~9H3?B3>T,OQ<4!fٌ.U1FF:n\ D5fb2xk7(~ߵA YWȋ޳=sYRJyӡ *潉QX+co*et-2I<VT%Z[T/>> , ʺu4v e;w}Qw}iۓo_ιNcֵHP&IWl½Ijq[''-ާ=U(F=,PƸQRDe}bHXStR,RQwШ&k vĊ JK%#KkavRxLma#1!۝^))J l҅$RߌPoIs8K2Uo dF(X]JXFm`<ӷ*I$0C9wի>ٚiެȣ5)J`Oc)wsQPId*{rzP:pf {_o֜0+"{ei|ϱjVඎxi^&|j:EGJ~ڠWo,qE<N{s:Cz%w4HY4 ^jAm?9Hǧ90M˜p=sYu4Ư6@0ْGYՈϴ)m R@nÎ#>=rZ=*/֘-ЯJ>"=*Jҗcv*U(uE)j@;ԋn< huiu ''!I4y9S8fHelв?z%(=9Bc( Pq늀 ŗdO{i r)Kkaޝ,BڕJ? ld?9\ \ h4҂;N)x&RؑN{Rtn+0z{Э(lTP'PWh91Jq\3"Ij4xP! QZ:eO!66{וw&K3{Ͷi /hmڪUӣ7OZ-0/VRܞ)ޚHbzte^3M Ҧ1҉Uh9vne҃y>_J`^{ե?1k'Rc,sZgz^FjK 3fǭzxz^ΚGSOp ;б=҆4T;E'r@R(4(+}ΞW{ʎ]DJL TZq=*vk6%/"5Z H+;%Mu^Oj>1Mc9 NV 7pOJ/ݬMN]EJ](:#LTV0ssx][e#gHj94Af[i&ypSIMnPsGNPh[F-pTUSNHޮhROjQ+;KիO.궏"+ޤn?*5. x+]W?63C~PE.2=OJ0㜭!!a$|9<сh!M5J6y<Әsg|yʉL[v>$dE?zv!9w= *]̾f޼ba+'6+<9Җ>d;&luw%h=G ~VzӝDʸ(+9v֨n4#/F?\:TZCizOFJĆLg<:$aHjBst,wSg?ҵ\T ?s|AO]/8ǭ3r/8U*#<ޞIIJmfܦؗ,?њ`bvқe[<39.%S A?!ypڏw~(dFe1~OZ%ExRRU3֌oҌ-!#=(bRU9Pc1#$MY pxjuQmb=룔c +/|F Vt`,c̾Uv=jèR~HlWTk".HQF(@jTSOJqPq&QH-lSQmic;CSR>QT?оdnE)?vho4MR ;jSKtԌhk R)>$mMI5vbhަgmϗM ?| >5rN)ĦVH(^c>yԦu?rYOg.VbsPNc*Lw↜}BlsȌBI{Lj-f?ջBQk9q^V-r; 1Jc}w"]\"2,ʹ*L&o|uS:O u XU7)>B1 f,Ar:ЋۥNnƔ^w|2j?FVXs}h<dNWIgiZ_8INs޴9dR}kmdJx UIhyԠ"$My)TwZM֪0N$\qlV?'Z?*E9 ۋ ΖN6:kr<I+RŝTç۞BU'yiV[(ϳP* $U[}IL5J$.6@TNjK'U5 {2*vƻ[O?\H^y5b=)zʹ{U6.P4hZgz^j{х"iNHW$ǭ*Ȥ *2,;d V_%ЏoǴ? $T&9w}Ң<#}lEۿ d,4]~e流Ry2q\R-Ci$*%JU 3Tγ =rkR'IQY2wV{i)E'L?5Ɗ9AIGSAG&| v'I5JvyNq=rǢZeO EZ޵_uv^jוZy5JsĻ~[S9YfSN,$1ʃi ))<*>@ֳQ{zQB1I > m`U.%$ԛ~Th,MgX}+.K V=h~m;˦Bwڙsr?Z) 5z\;{}~aQM qBE^L3);q]Z҂8b~^+%C*ҕ.RLR҅hOCN# ]tX>}iQWmă"][~> ғNU02ˊYv#Zj$JrʡD~0MX~qIzm")Lcp]2ÂDUtO4Rm!3H& ]}kT"qiۃ=ZO"#qڏ5$G,6v96Rׯ}iU<Zr&XZS>n%*\'Ÿt-~&/ jܩFUc:L:e߻Wzj?;˹\0['?S~d(AktU:iҟ{pH`Dž*?^VR($7(vԒ-© nshUAR cJ"KDRoȓv;9ϭV #a ٖ?wIX^;T)?ZHرiգES)ТSOifnIՅ,rI܂(4'WƗcx%c)N2H4Ğ;HRqFv?oSZzb3!f'k:&UE렶j` zW.Q_矋4] ^T ǜ tb2i3HnƘ}qI ~~k#0GJZޤE.sJ {xP#0i>_J*`uFHZURvV_j7k`NBr@ꦘKv+QKu*sVx~Zo =徢q̃e'kU4)ZW֔ntFK)Slm?ӊV֧s_k8&Q1\d[{sփ ‘?G]c*2~oCXG|L:D[Ґc90"FsE9lJ jyg=0ա'`m-t!1UU}Fӷc;\͙If2fX+RZskS=rTSߖTJWN`Aix"̩7y1I*˩_1JO/$ pp*:/KP+$~\w;(kV@Gc׽4{d%-31(NMtN:f((ғ49RnQc;?ʌ2`K"kDLjHފ{W4ֳp QG>SEoGGj43h.j:.>ukYL}4Di|弉Aǖߕ9 ʨy>R~yI3G֧mZ.qڜ%;zև8ߊkZ@~_)QFV1 1SdҩqJcP3޸UQ/3rsZEm8P ;e8֗'P#g*QOQ<>VaC8#o|~{+i,;cw4LTNp1~OcϵHNҚmd~V ѥ&.FkOCY m'Z@>\pscN6s%niJߚJZ;(}ݵˈ((WܱH^ڂ?(aV^O1TVk~=*p#Ը?'%JOt*}#7Fp:AJA T<ۅbo}:cZ͂5ǥ,z=? 9+F,fP)ꑚ}z;ҭ2c+Kސ Ͻ8_zƢϱw vMB}Nx#1SsM`sVEej ?ݙN =*:w5['^*A\ӉZi784da]:u*6ܚap( 'kb\U"*ޝqc3{&+7 Evi:~ Lt|{SIzaYWԽbŬaHHEV6ݟZX+Fܱڗ;xCgoU;!Hҍf'$T% 4$sP܏X+ uj=2mMcVcZ%Fdeyy4*플cCXŹ#r@TI)Rdmi3H\{| Vd>Ԟdm(YCf$&B")ZNW[ VUݤKvc#LO^xQIs9>vHϱF^W>)qizJbʻH⍮=OjmSYWn{S%?.6ܔHQ8V+\<*1-eg걟)X(TZ3ߖ sYvH~Nh7-zb rp=)UQ5OH^zRRt(|ulb[iVF:Bwp;V"+UbiRV6Ex#QGԔY#[?knN85xrE=8[iW9^r1JBo Sjn"umT'=0~Px]lv0 W=Rm'f+^<5bI P^E#8wuǺ ݬ}]Ma MDZҼ_CZ8S(`*'+v('4vw(8Jn5_cj~R3FqW/?JOUsXWMK(1隫t%\H5koA<;`stqW'I5BK&j@ּpx)ԍj]*u*79" N1$|k`n{sY? ]w/JROfV#qWi_9*J .fd1Tzq+"=F`qOџ-=r:Ss "E vjk*~0'ZQvr#;sN8+qP}|Qv74ܺQ$iwr*ʛ:5hSXԛ}1P 4uT#}(=i!EE ϮJ5 Qb?5(ҜDgp!).;6& MYu Bpd|׶2x#4,YJdLⓐܢ)oMs0˵`T&܅bS ݩ3)늣{oFF>akBTQUm7Z W^5T'Z]1;Od?ZQ0̊H֙jZXq>S*E +=nZ_u*5zT;Tsy2 z#!MN.,ʥ8/fiUqP ەesZh9 ֒MGz9yoO𚫊޼Q+U+<9e(۸qZ6_ʫ.gUӴQMis&hֲ-Lr%xOpwҕ^W&惌k7)IU ?1Ú>޴~;'m'kT۱C =67TU pI#TzC&;)ګ#1bXJQҊ"F67pUWaڍ✃)).(ZV{HU^;-EZ*aJ7lj) M2I "nsvyKAG BF.JTWyMJ.iѐ H{U;?,y\2Hw#S|4_JzE7qh$R@JMhFE4f8RsM ("\THɽ,w$8=OJlb0iV9!k6IeB-k{4<I*3^ W Ta,`J3I{qItq$Ӣ`Mkh@J.[k%eˈƎiOqi[ oڞ:12S Prq.>qN[ɔ5ӏiIҦ&TەɍtSvs^cSQ*2ϠwB:99i*T(Lzm섑҆-.Wijog<[UmmzONT'R|ަbSӳTN ^oNlӆqKQK괿_SPULҪ>Y&ǮQPƆ<30S'RGrRT%.߈ݲIp :6Vu8JqQE7#cZg)U`S8wfOJ۲_>`3OYI$GsAJzZSS O~斓/%F9o_!Zl`PS/$bO[s,xW0 (cEKxёdް-T5o)VFR t4_ww4ۉ#$h>&Z䪎^XƟr^NOa)TqwX}+jкq #+}躘)7Zu+ ѽ⡹&OQi(V#ڧӊIbb"iσ'oji ғIZ *HSrА0ӥ0WfGg\m'7S;s+QK&*: S \ƭY9oKvhi/_R;~?{D5S3K)>j}8&II)k=WNjh$#<7a==iz\9Z̛$|YԚ&cZ)AɏiWi$sښWRZ]U5t@09Ay 7'<$.V$kYƨ}=ET`a ;rjFߘ3JA Үy=i7cAc#B֘+=.384~mE 94H-2r=znۄVdzMFONOAO娅Xn«\̱]/R`ďKno)Oֳs]\<\9;H[呮 OJB(PFqq<39ozV&ڳgNt<5/:$m\ eޚVB,ҏƄ䜏J:!֜Z(gjLR2 TIęmhaO@> [CWMVsV &zT:6/S78UgiM^b{7J;Ttӭt'T&ڌN=?PFɞoۤk[|JqPdm]"jr[|ƹѓ)}OPW+w!cCtG-m.A͞(>B? Fw̌YEr|ts(*q i~ǭQ.vBA؟u!~t|cs4sTYv/D ەY qoJDp IU+:*\'ҭ=/T/8JtLGT ƼJ4ݑ#\KdHz5ui)}Vb>[MEIɤ'Vx=@qsނ5YGΗժ([MFs) ^IYB%?}"5փӜs< v?m{U.J8qR _U5.3ڃ 5EdO1@f^8֗bR*EO]*|,o㎽jp2<؊Hn.2b hqۭ_+pj<ܾv6Z.]:lMI@nFͱE1;qS晠g 6?{aP+P3ROף]^8?$8'_9).¼z5!~/Y)JOiR RWhW ⚑3Jb>GOZrPZvi~TMk"ΏoIQQѧrzԻ`+֫p#qI |?9RgUCj7ԯQzܱ4PyрylMt=rGL4naԭk*.Juy.)A=SENK(gdSΈ\Rr0i i_<ʎjo:gt?,b'84$G&jڅE?C,oΏ-ʐ4Z)RU9<{;r*nʒY:G(UD:1euV*ivzN7PDfAhПjEXq)GҡܬrZw9IkԟmzsHI)(*Q(?ƚby=iGMyjGZjU&MTQ{ -|#q/D(?F݌57xW?gԧS SVԿg CQ2T=K#ZΛXUpqMKۭi qbkNiǖ 0Œz3QmGh=i*RKP;{ ? F{RsS5CV :c# {CjZ.{t5bwƇ y#֜xJ^ȤjkG aNz?5j?0.3ڞx5>S5+_IqƯr/ЋLʧȪz 9$w x.k_wG=vӑJI MY'c=(\SN~tO0;{ь{ⓓKbsuܩ?SJ>R˃)x~^fU^GZ'qq"0mT㎦- ApS4mF+\sHk=.YsAv֝A#?c.$Niv. I;~۳T"fUJcUԖOξWCu̯WCfۑH=Eyr2x(UM0ǺՐCUa;x5N+Vt7 6ӹ&r_Ѳ|O~^8v2)x+Eq>[ ⪂OKC i >"~铟Q\~\;WG!ō^ m[w6B+gjbu?v?s V{SJsU,Dy+k?:J+=eJy'4>S4gPzQ%"1QA_Hb]iŶ{2xʶڻHUdjĚorkͧ5(KcɥV8ZKq)9 v('k#=ҕ Cz >>3)e4?E{z;s"ߙΕ?JYR,=j>AMMIy癤0HP[6QyhNlg|g<{{idA~^zSCqcxt_:~TBVu䓴Ԋ/?jE5SNT2{ӄ?:Sq'(*64صO] AgRy ZzF,/']ϽhNjLu VNӞoOsv+J.)CğeFQF{Lb<^r Iq x%j!V*GJ6F$UOZ[ѨAI4*J|%7^ :r89U[%*FH_JJ)xhM9n#|ZMT\7;Wi8Sc[xooKgFOya)IݣxJMY`u!OCgJsǥ7qW\Vr8""Qs^EkvAU,|M!p=7T!8Qްw<м1ʛ]I V'oQ4(|ҍZs[֖(VN*aaQ>q׷'5莝ozSVv}r7$ET}~HxKsT}"~RGbʖ6<1d )mצcZ\2#U4~i>k"ykhޣ nAkRs4TPDdEP8T'~iƎjا٦kV;&_%l(,gM(2H-BI-3Ai3݅~ej&9X冬bz SOjI āvȣ)#ImI\:uKuXj$R cm7ww+ .d"%Pb_JS\HoP~T)U zGɷS=B) n#yԞZbzRq7R~QH`Rm 2~,QۍSzb!r#ks&4߱۷XcHU㰡>*?x1s*Z0vz+>ݺ!_t:#Ǜ(5\0N) {l@]Ӧ@NbRm4.Eԧ<P{;g~yPR#nGqQ"<|Z[qF{y~]Q[M1"7֮i8uCo1?Z*/^ާT_i窬MS#&y}ǽ*s'޲Gm?5%[/b"LdxjiI_Vlr;{S\>tW4ۍ+]HXZ;6@C i r6p?JFUVkTU"\noSiK)BHÚZJZN6ێ̪ޟya@?J+KL|_EW3>Xa[FJU~3/|'qoJyK"|c^n*3qN6;Qn(RHqUk>i.$)*;`ivsڍ8xIW5+V55G⁕$gS)44ph`pG\cD(?٦̼BJ{:'V% uF2M~URQCEaHn#bUJCGxU,1&SXn1NԕF*+'B A!*`)vuIGqG@A(QKI]ڪ8⎃4>Uz߰F~v-޼MG9-cjIGWVn >DLǜi۪۟„y#JtCT V = USޑxJU~4(.N@@rxPS C)çU10w-ߵXv\bi҇Ti:9HlU"77%y9Sj O-LC8*II+ٌmhF8^:Q:p=LP}-Z*H3$b3Ӕn (EA@dy**UFy 8'U 97N Q2?tVVo&.̹sӚƌ!t9B Lp`OjmLsQ^GX*x1|EEAIz'MJe={S"NqO 9斁I1L-a<֘S<; _+SJL)b:.k?K uZr)7'RR 9dNo /`dƫ-(9Pkh rM Ηғ2)rOGOJSʽ)06vJ4t?Z:s~ݨN0z742q~irTs2'\1ߓַn[j;{W<͖$N7ve&djެe hS6)j͖gڝiCƘwI3pd'$$c@|4.?U/!|tdўqS:P] qX ~?*v?_JӔ \j.!AW^.M<T0"+1+*MCs[JB9=j/.2NP}1Hag(*e(^r,HvaLzbl^/5e nZxG/3KHG <)mx>]G_[o܌9l+/ѺTU=1uBV"5k!9;Q?*ֽdJkN3MЅX6m]<a+V?ź$ҥPhYZ.+Sz J#!]k4nU^zʻFO"CŻkH%TQw0Ñ,-(ſ FiL UnzQ哓"ⰆUH$U@V4cq^T*ϻ] IvAO!vΑ?.be} 88RQ WԮNG۽Cu ے5U5|%vOV$HqdY UW4X li ?)41Q#44a(yUɵ?ШtrLn8'?^.TP@n "[<H~ٖrP6MJ96үY˫~Tu q)}i%?k*aU/eYvG ֒Hǫc4r};I^bȹ}p2c~81#U"8FzqHRP3<xN{q=(؇#GzM 2tMdRz)+EGQoc)-fH>g9(Z<ґX3ZZ eW,hZεgVVN9Z3F"* qɭ DwE!^>U9ɦ 2O$5:앗+k(] 1mrUzƸE^ou"T1ƒK(&3<ѓ[bvݝ=]: rX,wE?0;Oqߥ ly4hWlWtxK^?tRH aytj68eR] #+)䑃Xߺ1⯔_*3)1k' \ⴛI|֓"CoR{/KH\923 }i]#&~J:Giwh8IM>nȠ>Ahqn^  ª[?:t8eY'JtBUcqYbӜ8 2y&KyI]ۯ\weqƐCMlwX]9sl$`욤NSypi>KZۻHTIw __&ےijR* 2c*LӏˌT&x{QG+ySxHۚ^PQ)QuhJN3E4M_N)ۃ1OӍݾ>붤[io#_҉c=YhLe} a'E4«ԅb;杀zBڑ%8gC:+NWEA"K|Ljk]Cv< #ae֝}E-tǕ$;_*?vk7Ec槛W J]V-N28>n$ލ_)9!|RyS対Vg CNRyJs/A1hSB"6OQG!aSy%W?.3ڙFzh/O-s\{Q-N9R Vw0%{u[x=FigkM<@ʗ_ZFԜP+5S暶(;>5OG>) `#VY x+T1J+S(ֶS{3WT{3yy }*}rWҥ''o̧+Zc*xak4jL4sQ&yW) K8 !4n&:I9b֢ de*Rl =JgSYWAg:yT slT[r#yʚjSt'>v'Bإ5$cVR$F[X0o.?)U{Tc&9m!9')sdzS"$+H['>ZOc+M*+:22Zg*r8枇+qQe5Q+mJcy>Sֺ0=z3Uӟ{3 \4r V8ژS5>k+R#O⳩)RmCj)W>Gec|-OF4ݧZE=CR)IOSm?CIu_D{WϳiG&b|ϠW[iv;gƞM0ui! Ii2Jքu~߅3H{sLC(Jb}姎G4ޚv꣱D <Ѫ*({TOt3S#oljsObJq44?{j(}=v)HtSWқ ^)6_ iHE i DosR5$gTݤ_m_JUG!P \})cRIO_8JmV+nf᭫Հ{(FWo]YMMn`U涀ɏ)qRB'ZGoVḗՓ,5FUB"%BEF.v/[j ;jH4,E5;)bguvUv ~j5=Ov_VG)،Q@Rt:rwTisң>>6٪/Cs3J ςݫ2քTNh QSҚשB'k{fy'$Mut)VoZVA#ZzPGփ(l9 /MoAri$YvӗU6_!:SZR$DN7cTCQ(MS<)5uҟO~)8?74ilN"S1z~Tf_H)sH)H ݏJGH{TvO#rX淧:ok/L>6aL&߷=+="ևsAIޔH:>Ƈqi(^YA>iKc;f ޔI}iOjoq]hU:Uk?)#^3EsqyQ&܏QtҎ 'z_5r;{)sKKPOSzi#GP5S]HtiUK+ ysǖɭ՗|2= {g<ɨm~FsW~sTSOzQҐvԎȮ 9@(CZ G˪E>//,95$?x/j?!]"\*N_Nk§3|Ksyֱ+?ZOR&M9jF1/ZA_h>R2JM::Ik>!<25WVizV9zwsPQr;Vr5~(ROFCΚI'Oƚ~ހ(B\A65wq餋kVVv 7JUC~w"9/ֱl#5t})N`08M7__P!%ϥ?jTiϠOHSHvKaj}zGGZ?%D~S$FuqkTko]v;ώFsޕI J;Gs^뱿K㱤_o-/f?H^R>ϻz~(SkJg9&~ǰ֤= gYz5Q^n#SӊوY? mEí19:~5بLx+QdZZTii4^&~U=J~'ƅ )_fЄêyr@P *4 0gZq.H\)Q ގM?9@)OOSSP#~{ӂO5c&&5.@ tO֛,қN S{qB)G*I ʏ?ZiNRqM=?UBLi^)~?҅I@$v4-!tXn)+hqIϥ=~7/N_MƒNWJli~?Ug'W<.IkJt׿#<^IoA?ƃi +}CҽS{#4N9>_B~Rү=W֔ WOEv,Cf›x``jUW |6*du{Xw}O;R'8JбO┨{m7,sX?MZ?|hJ);ROXݩAQ~"v hj;/D6o~HYJկҭsU,?կҭ|>=+Ͻk;:_?L?ݥt,ѫI\Ps4I4OӿS?dDFzzhnAߏC=z?٫5݀=}jDiR dҤ9?9lf=G|Ct?ZYp*e;@Gң*TCCa9Q~^+P}բ=O鞿Sh$}(=V})D<>Ri"i&iM4C#{cWӿJ~4= #ZQ~>7(?sC_/U9i 䞸$gQC6A)G)9 $d>>ZX4v ґ,N_֦OPO2O>}iOPI3m{ 72CCuOƔ A] #$JL|X'G8 94/ZUƩvN^9#ibFM Gпu~bH~FABCޕ{`gۥ}?E[G֑z_^ˊ\ԇ QѩM*!ޜM2D[2Gb߅,)>J ~4'SC94w9:RƚxšpjrSS8#{9 r(duv&_z)sIi{fp7}G5^-P>Z5} qa?qR:cTp)3.HIފ\W(ImOOAM_*_t=MM Kދ"\UvNҟr~Fyc4ҞEF6F ֢=}jI>*>F?8&o5ӏݨ#؇N؎N~n⥑TNPEr*aJ' DLJDȜE =|G9z.5yTg G=9~0eZcJUi"(O:M~ըpP_*?xW=jpNzȞDM*)q9OʘL_-Ճ<_ӢR8O_:>lq1+{Ld#* ?5aկPIK&GzSG5uJrysIY$U$H}*~:}*'ާy9\5-IY]w$U²g;uX y2:#QR})AԐ\|8=h97ey;ҧYsJS%})kFԟQOJN>Sm?4W+zŋ@V ?=^na?WU"?Gz_i2qGsI\#q6#uU)>j2O~/ZAAEO4I8_ /_(ULr*U2Dz/.~9w>ϗk[kBr\pM C4^>z^7c9DQER%9si69W endstream endobj 73 0 obj 417348 endobj 3 0 obj << /Type /ExtGState /OP true >> endobj 4 0 obj << /Type /ExtGState /OP false >> endobj 5 0 obj << /BitsPerComponent 8 /Height 182 /Width 438 /Length 74 0 R /Filter /DCTDecode /Type /XObject /ColorSpace /DeviceCMYK /Subtype /Image >> stream JFIFAdobeeC 4"@.0&4KBONJBIHS^xeSXqZHIhiq{QdxC=""=VIV"" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz?K3 ۫w_Ok]ieхEOu}u>=e~v"7yF^Eva%f`J0}+(3i1^\B)@YS\fY 5/hSa{EF<ҊJgmj1\*G}J(WO#xEbQVtj6gj3WNRQq*_aEkIm>7OW}(}+(~O3>e]ѴJ+J6J(ç߇ϯ{Oi5WbV׋-Wg|~u^zpRT~ïWF>g[0u5A4jΰǚ}o@; (R>wCڽK9=kSl(} _n>ˬqÓֽiiL7ϯ{Oi5W>M+0y:8OkCOK`dg>J|]o,̊;|QKHk˩J1qNԣ 8f-QEQ\QEQN1V4(Z1@<ѩV:>1QAERbRO +5p)h5h \8 oS/kkp^T쒽ࠝYS_QEu`ӳ>:d|[b+'k@3#(9}k@; (۞OvƘ39 [aեs0UiFky Fkm4p9 ?\yF^Em?f`+} OTiz?ٴsjּvqױcN07Gr0GEWӞQEV'm-efOA}lf2=81T S|M/kFT/yJ̡sO'ekvUfHʌ8u4QE|QEQEQEzUڴyIdXa-$#u}>WЄI.~ץOKF܎ [{Wf5$_#[ t4QEtQX0,"T)녮Fq%dH&GN=q\w sBu&2+l4_Wt|g֩[Ri񥷙CpIe?pWki47s ʤF[<}ٔ(.-嵝6D8e=:+ѬgU5c+kǛIrd?\׵U_g%Y M].dXq̫uϝIry*ۢ+O7h+8'nT?tOXNq?QXbiJ2T, }f5}&Oqxe\F?\l֝6‹?ұ+ (RFI8"mk r#ELWkmyx"hJ}ZAUK0UpN[ZCn"(3끊9mjyڍ;m~B(|Š(|G$_]-p#F6ӕyOgAW-{HE{ksm9Hm(~yRnʢ(o \yjH *1Y5%̟z6 PkWUs ZT__VDŽ>ϭFYIcԖ5SGee^EsӇEh?/c_S< g/W+ C7cG&_tW1 w8_ƏK"4p?GUEr?#4eP6omZ1K^;Rc&}cѬQ75]x}EOgD?e\#O~?OV/?V @3^|!_s]s6PΗNqۭIu5秔nTx㯰^_̓Ɉuӯ}UF*~ʤl>u$lѕG?uW7g6t,:_'[E$CuIw*ޥ Mpw:pNnZ%BcY/n9i$xYwnN,.B*8l9Z<sj2[@ef? U=$Czz%3I3 4X'5tAGe_:cwpcgμ?\2 # {uQQgD?e\#O~?/_~10'9Z+3ʓ{ #S?kJWCl"3rٸ?.:cM w8_ƽ3 S}q\5Ҝ["2\~UX9%]j-Ӣ7TR7LuSePOEsӇEh?/c]_ڸ?_ژOUeP C7c]$ҬI+бy]srXRkrĭye-ZFAwX&Ncc1tU)?O<?܍ 0FW]سRkQC^KlIvsxW=EQ^EQ@>Y&u`k{ D*v_((URϭ ߑ]ytG,gS+&%C)4(:h^Nwy|׷9rE˱E]u(8G^2x`+r7㹬w_y6>H_ι*֛nH꣒'r}9Rx՝ъ|C'Oaι*ޕl7ȣ.$(-JV84pw)4 u֟HN#(O*|jF| ӱ9e~P?è #ҘArW?0'+5KR mFxWUp9c񭫝je9Vc Twgڤ>&3~^\H꨽5XTp9&UR|w abmEbJ;LduyN|?qOwr:.pƹ;Up 8${mi;V?xCG,/ePDn ׅY"vq]e*1,K]sKqW )+DkϠޱ<{eC miwZRWlU/NF~_jm˪t>1mսVD+=_ҹlm/c<){Dsݷ5{xۿr?Q.TFSyW7EQ\(QE ZJZûnlX>EQq*ERQKE{K)(« B(4y&|xB.2yQ]'--ʢ59!SY~> }~V}&]KakRXhG?--ʢ59%뭬 [}DCJL>?+Z(Nࢊ):EHj"OO$bNkiZLFZ Ky9[M~HD9ڈ^a<}VTceQZEjB·nY~pyƤ~_tvQSOJY<#9S[w7EG$FkRAcbLtŴtGr)Y (A1T4>ƽOeJS삣m$.qjJeǑ:A1\KHIf9$4Q_[#I#;Y$撊(((Qڊڧ?aFL((((( Py O[Tg1 y_QJBGҒ_-ߕ[q*lĢ7I]φ>ѣCKE"-ߕm7ir빧Fs?yO)k;_Y1^$9$DZ༷5J6zcƂ=AXo]lYQ[A"/ѫ ָ8zu6{eF뼾Yƣ݅s$M=,pW?b\i3ϥzn:)hCB?k\ur3w7IjitVBs;m+<k Lɸ5S;>{W\}\YAkS5^cr{?*݇,-#88rsE[hYn;<8Ϧ,pƮv0ER~50 U,ھKuG) wCCrG N8zy$>QIGiep";UH ~5/IY`]l#U,Xj7x-t$ d1^Gv|ۡ&1]S5[=9 or1Y}*Rm&ߑo]xW6nyeeXG|Q zz|VeՔ)5mP0U OYЛr]aw|q?VͭwTTb8F8۸ϽE곣2,qGqEf۩,ּw/iF;CS?*,1_ Y)%Bpq#>Kܣ,P13ԓSWS3?lQkFGEded#*Tٚc*Fw;\~O}e6N4Nv_C*_bQѺH0ʲU;;Wk#XQ^K=ȫv? i+9YsWOmi$M `1U !F9bEqm,-"D(y+ΌNFpx(rN>C;zѩ35 Ydd (ehOy+$*ӚӮW6@.$Bw3hV*c`AE/oʏ-ߕxgf6wo-%(Fh(V.{WO6wm|22 J(u)BJ]4%Q@jJ/TtEQE%V焟\lQE&ib"e4ivi \玝?\Wb*W*d|sZJJ>i:iR(.G4ާ3k04̄>!8BV)͵H}޷jk-$G;ZgF}kE$G |$h~buͭʿ}_a] EdpO9,էY<ݻ~n9kE \F#CWo5 IL#;Oָ>k`;ef[8ێsbK5*єckl/=$hn('SYWS.vqZefo9i6|ֳ@*є>_Gw;LMc/|q=u&زIzuQx~uh C]iKO8~Ǔ)μj~6:.a bm{{׭`xvuZ[w"\=:Pr5 V}Aנn,E$ 8UKz gGʻ9W֓LeFنT}yV lj$B"sx*Ro([F^ien7Dgb!a8Uͥړ n"[o\ RT4QEͳZ7;} EQEVgQEQEQEO >Qar<SW[鹿WM{E^J=>"φ/w»y?q=9O\=t^ $,y]EWQEV?t'qYz[ # Up'xcxFxX%(@pvAPTy 6t֭4E,,6)V əoUOyhإv:#`GlWӇx:uivm]y)boY#[6Zkr  .=};N)zrfwrࢱDVs-5hl~:ۼcMG1{GV=}z%S4>[2ѱ n85JE( QDżQ黮2K.%c*M1{̭2d_s^k>Cu-i [V OVs-򩑇nx_:oyΡ"0V/sП+/Wi֮[Zo5  ڛuIh֬_~elmǿzm!3C q]ֹY?n˒s+ԵuEh"Rr_Z,cZ$!b[!GYɈ4//rڦ6f[ĥ[vY5iZ|bY% _Cֱ֟j2bݷ18UڃqG\з7šKmr-Y ͼ0WajRre&sL5ILvnS[`~y  = l#>cIzci=uwmp32Ok?;o]C: :5VmWN IyUs]P^mO4SQA/R7NӷQ?*HezqZK?\jeEE_=?JѵFV6H)F{or!tɍ`ǡ?LHbS*2SO\8TJnOke7rR--ͻJLz~ͪ3o D~WK HLqUŝT^UuF=Hz3(ISVf#EY2*yF[?e~6hW}\n=+<[d,Ep IcWцU[rZ騮j;"ofEQ@Š(vg%Y1"=\ehkilZxy]\SJM( zx].$_|sYU+k7 R6/'J3EҫhN|(+WKu(.xuN+jR&Qiwnߐ[Nk+1|2oׁ=޾ٷqnDQA\ %$IRXMr#OV~V,*1moti7K&.mHpĒrO$.4r^L<Ƈ J]n1x?i,Ho4KWVl "~;U꿑b!:u㾛re7Zү \7̾x?jot|cUV~pzx̯%4j8>-嵙6תT˸fO:q$,'u+Rn^<lU%FᛩEPy'gz=ʹ֓43ȽTy_Gܳ]閫33bs+Η$Iy,e`Ƕ>E{lrLWR}/lvU薫(y,E¯ԎXF5RT~oM> JF~j}e;+~ )fz]ʰ>TB~bSԎXF5V`>U'W-Ǧ cCjpڤZ$L~UEBB=ozK???/:L_|W4b^Z"5yNv_?)9Z-^М91ozůCMƙm6I- Or8?GUWzbӿ{y6aV N+ʱbKemò5Ū,} +Dk*pĖr>S^{]m-i*HۣF=ZImijZ@g;5^4<ֻZ][in9_tQe_VvqGcl;%?\T+0A\ֻ^uBBǻk` wit=Re!s yX~.4ԙTf>x{k na:;ќrEF-/זm wkoj O55+o7KIF`q觏綹jDž5*hz.~?eOk:剥O#_jrGuoڳ~?eOk2ѡ/VIjRg}Kk( -U>3"Z%Lkt0Z]Up4AqwNcb ֛HgxfvwRvjmoG՚&kDUBg~UDTB*(xjn-W_>ψ:pCƥx\Tf{3Ԟ!ѿ"f1$*UP&y=O_ZEH8P"*P6AQW=uIByY mx=*%>K?}pN3ܩ؏ι:n/Sm>cak:Th[mnTéo_iU+!mWcV|mog19C#qZY!RAW7Er2J<!`F"}zv:L_|W4 H3\(@xS-g'&(XNu^wo X(LSCopn'U!m~9(敱/[/s3|*uX k{apȌϿ*֛W%72TUt緧Q#7mM: JF7~Yn9}Fi]빬r5c֍һZQg Ԥ,lʊv9El[Uk}JF7'Zk^DczhO9Cc_z? 먢KAci%ԗL͘NcV_q@+#^.2ԫ:x_uY_;.2ԫ:x_wE~rO[tggw<.sijߍ.|:+u$'WV?-_ kϒƹ+S#O#cG&/>+讓%Y{KuU#Q'Tj:?G"1߿tWOe?s?~7QEs_?~ nos2|wr8kwS?sb8\= T5[jsbX\= T5[jr?~aҭSۿ55kܹ?-_ kϒƹ+?/ cG&/>+讓%/kL_ fx?1_ ϊƹz*6p4^Vv{ZE&;ݝGNwprt4^PD6{֨QEQEsQEQEQEQEQEQEQEQ@kc ((G rU9[92G?ue}&z}NO+U>krI1>G6<qQ٣)봢+;([{|^2>ZE)AJ./fL*m>{|)2FUs?*TUbڭ@P;uN?Nn3'*o]^P?R( (#q#0z)~!qj/8YW+2 >+0wmϛ49}?\q~ )-afvQEQEOXNq^yʼ6Q%m*.?+3Z§S3Z§JZշڴ@$(^y8T4ԭǨ[* 銯J))V|?B=?iØ~jҪʷV)hXJ\z#QER Zo9u(izMڵ;hJYa꣓ k{樂V$=_ < Y JIi-W4{o ಞ9?5N/[y\ah-(ʊ(('4QEdˏ7Uv\{b׳iT5XִݟkJ}xՄ Fs+VO}q9TQEQEAFl­w23\\#_COuU5.L77w̞&hxz:ժ yDKA~uEWzEQ\G'A1lj'6SC?ze# tWzё^e3G?? dzו]` w돝 \LL֪'s5-Ώƶ/-2sQEQXrC>QEcM&o>J8-3^^eFkcO<.>uΗs=F%V75ytWzё^e3]pO=S#֌Z+r=km$,+Xy1\eg (Em̫:oCSEQ]5$e)|r-yf.YGɅv XJwָ+r=h2'FGy]G[Eˎ6}~_\hFppQTV=S#֨kFu1^{kΨ(xRGH((9!,Š(0}F Cr=k̳FkݡSN4w{qx4N5~ٝmϢDNU&B=kM#ּ4fۇ~? 0_gdzё^WEw~!4Xykk4W56l+*jN[mNU4_|s^EQE8QEQڊ* Μ;`:IťQEQE`|QEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEHuBvQE-Q^ZI+ ) Q\e_>ݠQE ZAK]t+{\owQES֬iɮ(J((?ϰQE%-%UoϢ^((>((((((((((((((((((((((( endstream endobj 74 0 obj 20853 endobj 6 0 obj << /BitsPerComponent 8 /Height 87 /Width 87 /Length 75 0 R /Filter /DCTDecode /Type /XObject /ColorSpace /DeviceCMYK /Subtype /Image >> stream JFIFAdobeeC 4"@.0&4KBONJBIHS^xeSXqZHIhiq{QdxC=""=VIVWW"" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz?㨢Z$,ƾF1rvG.N㨢IdHI{M#3U920kJ5[ 4=L6 sKPɩ#wV暧* YvzuQ1i;O$1Ix-o =T2Ki9!Fx|y H$kp 얛7t&+;-o<0#>N0[tŧǦѶݻS{ Sј @BQP =c8G8qU/|,_p? 'J9Q9V#ZkХPQl[hz6v[h[?iGqnϟ!`Uu hdECctHtx卣uݕeGk~?^cqo- ކXy!{9as7Teӧ'?crad]z3,4nyOnm-.A|ݳ[MgpCQEyQR[̱՜Z;u ć}|?myZZEqTʟҽ<.Rηg9S['8SʏĹXsybDLK3(UM*犧eaf"ȡ{޷x},U^Y/yX‡uEvY"5ԟD1c<8Ef,Ēy$D^,R秭kV}[VRUR9VI'4[}JXheB%bw7^{/TXFon#!n#Y~S0^Awϡ=Zaq%$G؏C[`Je7x<ε''xV>!?1,?;O}kҼA8PoA)'כԖ󽼡ǡSXzu(ZQF//4Gd'`u%]ngB?U->1@7wb<=YS}-#VߋtƸo(Q+ѡ٧EJN\ŏCJl5$CGjPEHw@I5j;jþǯ5z;ojfX_ƥT{oW[ l=wu>;ڷ?¼j҃+˯=m9Mu叻&ի݋y(t|_¡ x]`sloJ&B#^'@O 0%my /ymy/J? e%[쿳-6qs?+E5ЯGjx+UZuS_Uqin!+WEYZxg*9>ظR}o{h/d!zymsh'I>LX}G|WVniqsC]u=?or~[]Ua;ݟfkV#6Ż7Otk&#:JYKTrGb=81ZAűk\֧oR*)ʿOIm3[NU==kQzt% |u5^>]xJ/pGƴ)*[[{w1ȇ*^U\2?*=;RZ7\v."ֱgES,մ}@P$Wc5KmMV)vs~Ww+n$gz%h\˩#iy߅cWE 5Z5>bJG m*#7XȿRJ}ߗ ASQ]Чptj8; \HdeYLK uzf Y!0R?]>F* IQ /#@~zd*/L<h:t1a_jٴH߽u4k^!),㐿kn弜+Ijq;!˹ɨ袾)Ͷ]G.$J(( *K{monXP1=S\чVûҕwzr|OX!sXWVyIlu?U֮G]^!_S֫IJGqժSRN%?mlx!WkƯGKyZYSm'?`xI;GUK?XsLKeyxdt>1ى?{(C+ARO<&vw=ɨ袼VwgnWv;'(B ( endstream endobj 75 0 obj 3706 endobj 7 0 obj << /Length 76 0 R /Filter /FlateDecode /Domain [ 0 1 ] /FunctionType 4 /Range [ 0 1 ] >> stream XEU o'"sIq  endstream endobj 76 0 obj 34 endobj 8 0 obj [ /Separation /All /DeviceGray 7 0 R ] endobj 9 0 obj [ /Separation /All /DeviceGray 7 0 R ] endobj 10 0 obj << /BitsPerComponent 8 /Height 58 /Width 105 /Length 77 0 R /Filter /FlateDecode /ColorSpace /DeviceRGB >> stream XXTɶt7Љt&49'AAEA$E%((Y@r9,Q1bNc9W-spf{XUvׯW]ܹ޾}+.ŋ7oހǏ ~= wԀ>} n-A%0|ŋ h rP^~ .fhG@oHoݺڃn߽{V Pȑ9`K__O pƒ?"={R|AEcOC3SoncQn~蝋M9w⿢'&<{4yb@o 4@1sgGq6إ%{Ϗ~şigtu̍v~q(}O4@ڿ~| nӓƒO'.-x雗@y—(., -A~{߷9 ]9}~S7/߾Zx5CL#.-[lAPdL@.ϋo͔u6yuиsXPs#~ GK\|\ّCknO^y|7nKWUWxXX7(pGmOdl(- ӓ7'v(TKm/NV\8\|pbO/or?q,<ƩkҪ $%Voh|UgM}o@nAP{;t0f|:~>}]co^&t>K0tlzn%}6kl-?7vnw;>yV'- %׻Ffrqa{GU;m܌y~pf͑iF;Uqrgn>^܇4o2R|,"+|wȖ'{-] Y3ˎe&卧M֟rd$48 *C.":HlEC'2z ϧLlRԾ7=4tƄə+?{~TAsܢԚÕ㇫+ںs zʏ,><Ϣ Ov^=`ᣅ'6>Uں$)D4T g1>H&I@ci]5} CC5 rk[sK;{+ʻK:jZJ&GOMU?\ypٙuY9IT̀w^>PPt)u Jɸ=(ѳOߟ=< ?CS^!6:֭[BE >p\[U֯RAݒ%rE˵u^s_<:j囅׫b(vXVPdha@lmfX8Qq(-Ă\D\ZH+>jhqlzp7:)- ⦮ʖU'jO)n8~HQPSeҔ2TM\`jT34~2uy%CMGs$7.|ܷ﹯>py'εuwxmHψ@&κ2{+X nn==#۟e(+CJ:w{/{oIQ&Kq[Њ}]~[\£]wlJɍEJr* '$[S108:^?Xs,`nzqeVUsQKwY{†δ̲ƌҡ U :{4B#Ý6"Pd &'Ʀ,FRb3Jԃl7EF{vރw2ps>naa1;6 dWpuʉ$G'mEyI<+:0}S:ϵ>:觋)6Wt &؟]bdQs\?@JuK6-C!qbRJ+z[;bRX3&@+n*oʭjN/o(ϨlL)))). ۭRЁ$Cfwvt5%9&6VƬȊwT[7w㩁'{ ;C,i-njJ.7}]Ы۞SqRhmuK)tzz93[پOOruܕT00<8'PA݀nmlgʓHbQt`0  R:3*v_)52#)9*6!9:73*[v$el9egσ)!!vA1I V4􏹇4nxbGϾ\}]z8u &<ڛ]Cq⣬$/4711~0`>~әy@ %_$`dop-M&MTT6̯p T+|C5W5MMo|0 i!f-uiEa^L"Q^I;8p^'7iƵEU-S2J2++GRK#ߣj&y@\KiLQRPD$]sCi[G&'R&ܷzýr֋nxS{m$a1V2Oz[Vm>ێ:I/£CurrcZOk Sӳ`Ox]Hn] P)yC8&յ1dTP>cs[@TѾ30HD\lbznm1KEvgXIi%C]Q{:d'GHԚ1]&)i4pJ`@D5Q=/ߚ2?} ׹@66ٗ8(wv$f +8\VXc_± kؚq kKVᾙ%뼵C=Ko3st%` qڍak8Y>>>~/IcȒlWG'$$+E)FTUᾒ#6~ݝgOd*pV:{l6[[]5>05e:``ρ](uM nm {˧:k߼%DE+XD@Di5i5%5{34ou)^pdU]+gX-!92d:[@!11q@gb2^HYǿ|9?yQ'$,K$luRSyx`Đ*]Y|"Sc򷇧n[_}h(sﶈd+C2LTyFTuHhk70\ft?b+Wt**ef֥w(hk1ضB]-;oۑ%!RuWl.RgZ ǒ^땝U6oaЉKI1Քf(,lklR3س-/_ GHBB}DĀ E<7KML123i߶.#;v[(I2&epڼsw`dXК i\@DTa&/ߨ† ڿuH䏇NHsJfJ89:DE)ZV6kC%8ܚ p.MU]=ى[ }d,ɯiߕ5f(g+S8XL` 20$6VNMEAڐ&6,bËZ3wgĤdqGJ8{ &IOw{JYQ!Ǔ%6#)+*`Z^^oFϣN\!Gx*MLBJdL=U%ѻM84YICgKBbN}CykkINN6F+z( m],/|OhxVBb`l&{:G!"r>~>~3,~g*-%CPa2:*vgLraecAUSaMKeSA;vy_G 肂xI I) ԷpR6 LST#K&XDz6o|X1\|%KEM#60GE("%1`&KcXᛗYM dq90q:9t#Xp/ۺYja zH*pmQGBwBOhoCБ#6y&h:%opW D%y=Zd:X\RHH<< U5[iU&ZgXAA!Ⱥeu-+,,E $P+=kum|A82r [3%wu(UE]Ȧ]u+E,Y&Ν$da8#m:d*_BLEma3ŽehBctkxFGy6`Çy2aj)(@`'C$B2ȫoPRxuv:p$ dc =ssU=}=u9 ;wE{;w}<͛7;?&/?:LkF 1 endstream endobj 77 0 obj 10593 endobj 11 0 obj << /Length 78 0 R /Filter /FlateDecode >> stream XێuSq2{\A :p8/pFd[ Ar̩ow׹~-Kq5/.o%6||w#>iqÂneOӇ>.⿟/svr_zWp.%zS|+GE>O|\kvvM1?7_>^^_cI>]˽nR.l\w/}ڶ}zǯ/߽t՜W9.t:ơ/~wy0}oʓ71e5o_;S5t_bo/Ȼ}±HZWp5-qX0~zXpc_%{6]<˺|G{[w)xڅqK{}>:,";%m^|DJ1V]s*,pCF>6_ ; #U/\_}~N?^?%+?]{r,5^]W`_R ܵ/v[[؋jXDJ%O_/>K |y 6.Ðm}0n|&E*ğ˳*>}K}->c*}_ϸQs/?y}]Z8휁˽aÝ?]`~,ӧy#b.Ӫ[%rOZcg_\b;64>WUkcj]S_K_L aؚ[#<v㦇=oO Mk޼;/iutkBq}Peڅ[1TY_ۿOm(^UC?7Eې_]}m=NGe[R/asALMrYWNs L1w3(.է~]λhp M>;%:܎}HJ%J 鞊͘wC5Ξm! 3D5|Mi_}[6K51I#;[MiYcXAq,Lj>r 1֭BBV'1mR{}QQ7#r 2TU%E aZ {H\K\a^ L?g4 f$@~ơ -v(ً#ý/O*$NAq 3@8nCL \K#U>8T-95.3FRmDc K<'5 tHgFӚOkF`l+<TO}H<_Pz!9YH[m̿PoU iF>6xݦ]Cdk+OU=PEAV= Ar;D`PI X#+*z$,me9 2.gq`#It?T@8VE9~&KI*Yv"#ظu|.'vUtybÈ R7%aD0N'>F (O`>$ Ծ І@UL@``O$HJq1Zh$'q$Ue DNP["YcZu&"I .6Hl@*@E>rHU"@nW&N @/dяVwG|KXREFĀ ȼ;Au? HmBL nr%&P #(gNESnʹCP~xsE(˼~ (=#$25#:Up:sH9%f* GIR,&$yRYx3nrtt"巈zCv$"hf;,i,tD;"6dIsbau}ρ^9] rsbdjƝLd/2`%&j [D3N Xdo'Ĭ!=5Ic$Ќ$@)L ]l0Re9$+U$ $5 $`@6LH K_oud)\{ JK\k v K*DDl j=kzG͜uKwh\͌`Fr23̞X~&|lh"!Hٌq1 6g iz#''dimis%aC˾I1v sNsN~;'R79)E$IA`Ğ ' A}qT)u"@m)1B (<mQ궈$f Z%Q{%\4X`#4{Bc%Z43,ĵIw?w,rBqעVu4 WQ$u';A:N|B4Ʌ :x]0hx^M'6q袳 䮌 A768(|Px+5ڂ.#O&8 6Բb+JX=YY=!GRp H kQGȌ$Eo4b QbRIhXCPgbR01qdcN,ga<rZnOM'GarE6ШEhH^B4Y }X}JRy-bB)%+ࠓ~2 vvz;e,qΐ^nnYkX AΜX%ֹ(r\vP R䇷%aI!oߊ'";m {b#, bpZ>710ǐߞW%Q@ ^$ĒMJRF,۱Wc!L2|"Co55Χ?li; dIc{;ȋnhl bM>FT{>'"- ‘0a>rxfH4# R  ; ZhxNa$d(dVvșh^8#^ w 0'"6?(yijoJna$>EJCL(fgA ]sSU>o/?_` W_]CB<}^^c=~y|Y-jJfe>ӻ?iO8;Nͻnw|x-_{XDk҂GC'>VYĩ|@g QG),cBg;2܃1 a+" 2׳a`c_Oi_N GWo?m2k 5^")(HJh+;5ݎu.cn8Ԇ#q ,Fg[0ր 3$1R塙?}F (~U*oufcΰcet__UK}_Gxhj1#_m[6@k){Hþ= , p6y3O"d  `DGhX_"@5RzG|@5ޫƪtg.̺ĘMQ;j˒W6wUX(ɏôl(m3&8]= gs}6wݷ畹 endstream endobj 78 0 obj 4553 endobj 12 0 obj << /Type /ExtGState /OP true /OPM 1 >> endobj 13 0 obj << /BitsPerComponent 8 /Height 146 /Width 505 /Length 79 0 R /Filter /DCTDecode /Type /XObject /ColorSpace /DeviceCMYK /Subtype /Image >> stream JFIFAdobeeC 4"@.0&4KBONJBIHS^xeSXqZHIhiq{QdxC=""=VIV"" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz?㨢:(GO|#+5eH"  u+3puf+<9qoG?mVXp"BOԊ4TETUUFm#EHQaUF((((((((((((wݣ -Xkg=5}*]2eRwqz*gɁ|{1u/& /S-rIEuULzAr?HY~/5ETp[m8u'WGtb۲ (/ ijX |Ayp`?g~חLr3\Dp{=_E]0ֽsנQ^}/hU5_U}c6]M}_ٯAW_/hPzEkGoנ^}/hU4}U?=&o٥]M}+Q&*]Fe˒5jU*QW%۲O;3*IC'q}4/\O(9 (( (5]Q>fcz;A8ꨮnN: =YsJ:zm0p1FsF|]EMuW)|?]]>e_Ŝ"7hF~MuW)|?]]c?a_Ŝ"7hF~MuW)|?]]c?a_Ŝ"7hF~MuW)|?]]c?a_Ŝ"7hF~MuW)|?]]c?a_Ŝ"7hF~MuW)|?]]c?a_Ŝ"7hF~MuW)|?]]c?a_Ŝ"7hF~MuW)|?]]c?a_Ŝ"7hF~MuW)|?]]c?a_Ŝ"7hF~MuW)|?]]c?a_Ŝ"7hF~MuW)|?]]c?a_Ŝ"7hF~MuW)|?]]c?a_Ŝ"7hF~MuW)|?]]c?a_Ŝ"7hF~MuW)|?]]c?a_Ŝ"7hF~MuW)|?]]c?a_Ŝ"7hF~MuW)|?]]c?a_Ŝ"7hF~MuW)|?]]c?a_Ŝ"7hF~MuW)|?]]c?a_Ŝ"7hF~MuW)|?]]c?a_Ŝ"7hF~MuW)|FӶ}"(// #q?Q&%sB:O%xZKHm$F^Oc\?5{{=b&gm֝ KYyVjzEWr[ʣk/>4QN6DYU漴r (EK*F,*s]Za>]ETEEUCgN0]HF@!hvQv;R\gΤ>E_]pmr0LuنK01Nmp&7ZƧp~G׏Wq^{DhQ]ǪR(hWa1`˜d.J*J0W (-7Ca2bHۗb2jo}7Qi2/3hD絷Mkoũ-幙a2{ ؋EǙ<* ?O\j׌W\\!sV`ֶ]̰]a[QxN캉n DS$Xim䟼4ZzlrݗJ()Iݞ\)ȫp骲>.H/jEQP1En<3\)7QEC%l<2U\5QHDQEV~w1>Kq|-Ln%5sx,VvYi1^©Yc<.?ݢ)6DȸWj?pΈѽE`Yc<.??+'E[QX_M[Roi.[UJݮoQGjx\+5EUomУ+&L6Tij~?kOKSL"ԭ+ÁޟZMORL$3omέXxYR( Qy'񫚞y#y۰>q%8ݎqQpsRQrËrʑGor]U]?]uk},'F3`cޯX_ ƏJlYh7 eWhx\+5Ea,K*P{^?ZنX%F*Gzڎ&krL֖"_+,p*~\BʲUo m> mP2[+3q|У.Y&*4,EU5]: E- eWkvx\+4Sc<.?G oF eWhx\+5EActDnJ}=LΘE\r3[J5RRY҄oQPX]}gJʏ {ib1g޵h/JlG%6?_?pΌ~tkQX?X ƏK,[V='b"HKpm lWE+ӕVU^EcZOeapm lEg:Ş\'d MWk*=)rJjsЦe%pjNo.Vgq_X Ʒh/JlVro&=~wӒf e X\ޢ,Zӵ+?u]~EA}wJQ1y8 MWjQ-IYSF圬J*vs*DʽNN+'q|떺}I]vҭjtc7d]Ji#zAG^Ӯ+PN03ۓZtVn[30*Mĸ@m6TdwC^owY7բ4nRh UeMĸ\c zzն2C4r32?Z4VMk{wQLe\p3ZRIG$5֏57t]*ǚ4_]m3+pYW VU,*'fkiF,T g Pe!D ꇏ֥$ZL?ƼLUoiQbc15y>J+ͥCwP1\'ԝpϪou!%)J?4OƳO5C/8ixrN3]9v2>\O|o֋@[zeݝݶl'0v~y|}w_MR+uS,U?ifNi21gnh mWw )U(.QEROA\/ǨEuītyS\|u9v_ե B0vB'f"-fUHs?kSqG=xG*&q|*n>-W"8ВvQE}GeEQX~#1uH EnQW 8;t-u\+z+s:O/?+MN7GJjG'Q]o_ܱ>J稭Sm>km+:reNyXV>q6~u︬+Q]20ʑR+W-.,vOO7fxRg#2NAxcW4ep߹s?ޟC]}QEfdQEQ\ֳZŰutݢkJ>XW-x{a~L;/c\4^~TYqq).%#fEm%Ω|Z#JR(Q|u~; dOUOfS̹湘c$$L?]_ks7S٫eFDh[AC)E*pX 5W)LOӔ&tuԿglgʌ>5-fx_'D*v $gp;K#I#v9$5f*hHdda8*z-F x[q*ZdއpJ\cIGbĖ'5j&hH$da8T4}L0Ċ~kZ-۞iqyڕEw)r浼a)k!wOb*2k10o*]/! RUVW6{> E;ww;Kԭb+ZE~\V-AAXГ[5YFDj2+%0iR&*}yv'EHFT_?Ҹ2p+Z+GFfZPXLfj?[g5ίrxG1@ESTqP;3;YI=vQ+>{o K5kՏj]%1JH~+ϺuOcTiF/ }N}.kg5Ƿj]1)y'H|`],0¢?A^nij'$^v)Ӥhz9PNzZWiX# Jfծ/H@ݍ dln}f7m[ H-4'h$wӤ Ɍ^Ek<1f#?7S nNWpݷ$77I:OE{w fN]3Ɍ㪨jJDv,}05W+m< E;s0څ;O"E;wwijNh&dEl\A2ߙT/vc +MGanuZr}Mu/\_gNPڍds|f*>AUѶ"O)FHQ޻*/ W-"ɨiQH=uڭڵ+YR;A]qM:yQxyug~ _?NO~'םjk&*vWu\}KP#𿩯;-&#cm^;/\LçEAgY[}NDRnd6?JWң`u k5?dS&""kҭ~ǦۑDG\(QNUb3Z~,htiG*ön0uݼ?܌?a7_"]~j> \q$}CG 63< [k33u2ߙkK39&cj?%;Љue#*h$~rnsmkc"9FwTE,v&b_%;ðe V/2?\W}^m$o Q]UPGxFe*>MBM.^Mi#˲_Q\)#xhRiSAsurO#P?;D̹3 ]G! c r3FYNTEd ?=kNEĜ%M Yum1?+VIpS<qx_1_\wajg-+2|Qr;$XE W ]G%HA]"h.K +,0YA)ԌҴ#HN 1"oco 1ƪ~TՁ Bww+~?JZ#؊3Ya%0'wr[W!)_F$" בTКZ<5vcEvǑS)9͓ԥ.1l@zI"MzMpw,ycOu*  3sEA좰n%3K129o Cm!\$$U5eg?8J&֮JUX'h/ s?q)IX'5>[WIN:<V XF?`0ڝ{w"?'JTXTBr$mtO.3Tb8F1d_ƒY?I-c۸W+DOOQTI3'j:m?l~Ө#4w;I&lqG{~ ueiIl$]mP[d9Ku_~V%ev9{Y2;I#H䳱%Mw4ї?SҼYY^Fŏiw2nDD)#>sz$dיK#K+,XMz(Irv>| [k3#?֝ UlnE_\"-i 񄥯`R=߉?+{T\/ST%mfeAʫeow?jhDZ$'iBse)k!ʑnIEaxO?]ֳ"-</G@M)譻xSY"'\ou'>xZ>_ i>UuE*_+`~_\YT=#?Һ?JcҒ58%PGt2=JĹ #=PGTz=isEsG^B ҭc۷)#䌟ּ=PYP~'`0[2U8A5ȼf+L?5DgտBZy$a?34O1}?)IA8Mfn.l POU?EÑվW*c8q]tTFS/s'J]bY :kkk&lrK~JqK)Yg+T_I 73q?3%O2ykatdۂґP~0lx_3[mA 773vH?3n&p$9*Iiv(MdkC-W8y&;-.[t1M^3̣8b|cg؋+t!'_`hquE\q nVύOCg:cuǗc +\oV"]ۛ=6?ҭ˪ *'W<m*x5?htOIu?qܽw6cqn+㺯\\kV]ۛ?^O+3jŠ_U%SQ^/]ԢY"4- |C)F`<= K#ؚ$0O"/ etWpY@f;+5I>o?$`>c,*>APW]**G-^,-GAݏjwSDSj[uG^(:((Kih[k5ij4+ttiiAZ\sCr[[m.xdr/PQY[yC^wW4F}6̀asOR\%)˹HG*&ԡĻDA,Tֱk.d98=!5*נȼb*W&%v:WbOc {o }בP H5ܬa?EwTW DSR5+.eey[S|vwwϘ'jpwÅp>!M\UX'?k< ך\Jgb0dr}NjE,؊9?\=Q+)RI,GYzU{-q NY$`I9>ҩ Sam9Fк]gxF1ESOWnQs)U 4<;aMb|AZ+|8 rgX*1?\et2嵄niR(.G5fsŸ_yy.+,ъcle&KC*E݂5#{hbG@YW7LNnӯ-dkyvLgigτiX0 ><}&hN_-l/.aXT~bH&[iܼԚu嬖W/o69ZD4aJn׷V+< דFu}jeS5#1pk+5H?,Z1{ukCӎ-KLxURlJPxU3'-uuxS.*UL2j^Ygv<$Mk%ܓ/?[v:Uo|3ҢЬo>x_7Y*P~ 3滚|GfklFm_湢*@ӎ,r}?Ͻr$ A(+.>5K^O7{o0XO*qc>3K(뚵iDZ4 y@V w?ta?sld%R-?Q\J+$LT8oByɳQ5o2I$Qq:57~g?ָ@ 8k `8WƊ?!zeoɡy] pxv#j9*[$98v,Bv4Ts~2e/h$?U" $Ofg'*E?%bY֚dο ՝O9m#;«x=T9=Z: sKJ:.|u1b0drɮHp7:~.^Cn3 qw5UorK(9Ue̳ [S]χ-ͣ@ 1=?Wenn!㪒;%@U t|a"gis`Es60`בT ˺}~g~ɬvcVcc\qG>/O4{rC>ErPݒECům쑖cT1vP3o\Wcy)a8ه+Ϋ$V0ݴ^z\wv_1q;Ԍ;//67.3L˟P+L-_T9p˭vc +Opl~g?-uV~!G*pJ dl!<Ǩjo8T e Z5BŜ8EEQEMik5+x˷݄ڊ (罘Cmw5#;*"bp$O UZOዪ'HO@NG.GZѮ:+✽{"4f8UQk<8mUuTү,laY.#/:GyomQǭs5I+tWUa^\e!g8z8Wj2 T#' _01͏yu~-y6#WG/σ3G#[|cqbPvi #ֺۿ9Ýw!c DʿufBku!_*?ҹ) H夅Ŕ)>res)?7}ʳ2$ft w]WTyBs7[RʭLTּ滏L"];\=w^â)\Rߙ$~V[-SOŲ0r#dzIXK0F'~78.ODw-]c\IJ,1k~CsƩr>/>ϗ= $,Vv TndRG9?z q~տl/ң#A˻#(-.aKXU%qҽ k(U?k?/jYJڼ#֟X9ڊ>gEx8Tk#mwg \c,uc֟nA>-dVmxY-kiK!_f-ӝ5_S8Xz˩{,<|yW8>xYʱ|'j D 1l㝣?kj3Ჩ5{lTe;DsL:H5FlCϪ?k~{lI/a=0#_\9?r0XWri2Fl}Nkt!4e+$:m-r{Mm+ZElZ/Yc8$2kݢFcmbrya;"/K }-|鰉hJVAVeߩE9X1PxV&6Č?MֻZJ}+)<$C ΏPSUQO$!]MbFӅJrrgQ\%-yodw|IyFc>L4¹JrrntR׶ F[?`QEGQ]w"٦!\׭ڡaѭP%7~g?֯`<58e%G|2IJ!Ts[՟B`mP%7~g?ִ(cMŴxPfh†6T?OB= wђg~qDxBn-b ƺ״8#1:gioAkgfϾаܯ{ ?gvRXQWQZú8(>bii!]YFzO~uS/|HGz,EnGrzFƱĊ 8U+b%U:Nq~8i=Mv6m;E1,Q"(ª:(9Š(] :V*zKEm*GR\Vq۹Y76\́o<7sj4yT?wR-W7kK@Mݷ>^um ݻA:/-uei@vǭleծJ ,3bI>_λ3l5lD! QNeBxF4fC.vY;GCe$]cL]OIJs13*ÓG)FXAbޕh`G/,XOWпssm@|'޳rB"xj*0n *0JIbeUYkwGӗK6',[nOzƃv+j >,ͪۿ]v]&z&Uttۣ9N¡|ZD@7t*~U)ΝEg+V+<P{[N@e1p Zʏ‘$t̪A+?<Ru+na+ת#۹cZ$+57R 󼐯;7g=}"?ȥK( &OXT?_򖿆,c8$uՋ}o^宙7cٝRQَ:=%}oco jr1 YqI?+-Oßoݘ<XɬäH-ֺJ"e\T_?4=2gf23.WnMiV Um \l%Z8 pjroyO d֣a$g?]ehH22 &&MFs}OT;Tmݞ1=kGAڢc311rJTWjDTSX' Y ?#U nim7SWGRCKupeky~aWݩv SݝLHu_I ni}7S3۵t?zD&&u qp򒨇?-t!TW>{ZŒi#] sp򝱡O]=2H`cW>or-gF#"P;uKugzSl|4N>`l>󕲼MLDٿSWi>_uk;sQQcTw5j>7ܵ!/`cڛatᮼn9ϭnApݍ/Qj4TLW*Vm>c%ͷ8WTTim5Tچݷm>hPR4ۙ+>]NZ^6yw& R3X?z!a"AE A^.S)ՍOZFu] ECԦG"^HbX`$U BŵWo*?Uln,e2[?v?uMQ,KNQY?~_,ŪKns_t8O1mr䑎T~J*ńKY<+gh6ڔv e ׬5JH6Yv"Y'7?֖s,4T3ZKܟ]Y/i2kڤmtv8fQ׫o,IvT9\^vMX'ժ(NvG Q] E`U0XSV袊|C(Y*rBF\uҼ_>Y1cs^{;R;瑜N G([*rU?k^iu/u,ǘ9袊s袊{h hS 4 47aPƴ!Re 8Μe K`9XPIY"Ӣ@߽:g:(((((((((((((((((((((((((((((((((((((((((((((((((((((((((cBʨ$(Gd *"N[T[iV2^}[>" rMg$jalm%]ZZwV2; ~olIJ(8(} ;Fpkѣ5'Ҽ>k"T_×?Io$̏l iIПי^vEW{C((((((((((((((((((((((((((((((((((((((((((((((((((((((+L(XPvn;s¸S+dy +V=Q_|EQEPEW endstream endobj 79 0 obj 22167 endobj 14 0 obj << /BitsPerComponent 8 /Height 168 /Width 477 /Length 80 0 R /Filter /DCTDecode /Type /XObject /ColorSpace /DeviceCMYK /Subtype /Image >> stream JFIFAdobeeC 4"@.0&4KBONJBIHS^xeSXqZHIhiq{QdxC=""=VIV"" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz?㨢m#mEɯ%9(] M]XѝiB An!M{'lH_6_S,u>u9_W脧$nq n;Ǽo*ZMm&ƟqGuPZ}RGC/%KwF Ic6/gier7 Iܧ'pWddW)*^#ڇTNՓ)֋|/I2yl+E>%u22JcRԯm݇NVRUI^C<]R %HQZ'<?l{"kh0auZ ?γgY]M[Ew =1Xկ_ sj6"}u<ݙ䳹KKE70>Z?iۨCtu1TTTvk4RMi-vk0Zkx CqYUk k[6yZmQ+{Ol(ng,tr¾JXZPt?ݏ}Ԡ/T?TRFIgYNݾ273nM,0=yC{#-GgFשWRTz{_c2T{_n}~a{_q@>ea%chku#5Ec֒ys.O)ĐV4O7kox~$J*|^~ik˙sOjG(Q֩Kh}{ФtWB2Jm\3Z^ SPT!wQlKeZY۴QCMPkn,6(mj*Q%$7ZTWMRiߓ}߱TӱFOwu~M-ggnGdG+yw r^(͸R .}gIβHyTC}  PTKiׄI{- T.8a.;шx˖y_E=Vu.YǕv DG"gYi_j=A PS'?J6axm}-~Jib򬣆(IakBDOVn}zœ%O*yoٽzqUq![T ԄEh+pnzF+h?5fp\M})ݿU5'K?Fۑ|=2V{X ,& {Vi:VpW3eEusG" ٌ7ͣo1N.D)WKUF]V )p56]1HUH8?3o?SLgY| LwxLLq9N?zyKևmM` Sbq1VF[ 1π'N|RYkk-l4U/~;]iѦCW^=E/z;iUMWK=%NH@qYZos'ҝiZ-qmG֑[9lbf]U~-/_}큁Ӗ=yŘ}=*]7VhĻȻdo4{c NDS;u{5)Z)3XGg=0$ T?ɋP k:šx4䄷B}=*m7VxEJJi=呥v$i=ܖȦ۠\.['&.jz\H1'巖Ekko\['&($(((((((((((((((((((((((((((((uXԶiOv:fbWWS~H1_$}M|m<a)J7c_̷sX鞵-lEujv8+B_XJ+2HzӢp95_6xΊw6om\䯛<\gKk6o-?!/3TwQԩ# SF#QɦZ&$K叙9,lFsZٹ:v6su'+_k HW:sZ"FTpƘʩVg+:Ox?Y[W3ȾeJouZ ?γKJ- *syD;5Z7J!87ncU%g֎,"k&v'l~Ql3ZѿCiV ;@udYUh si*˵GOij).u}2EYIPd*s?ϥtΕ)S9yvzڷʝ9BogM3OIVO1XWA*ϧH6WGCaKyo4pgª繫cI\Ta**{+)fz(5u+[\B"ԏ4#tr…IщEMgi=Me=Rjhx%dM ˩ Ma#Z4icE,p$֧ʅk HL5:4jMJswoc6!diYUFI5t+ &#"9% &egmeg5le,K6I:Ʈđ4f thT*Ms~A~¯]8-}8hQъ~HGГZ7_<;']{}#LAE*@9쵑c1Gv;U~QZW%՝ E,]&DguDR 95RKq9Jt,fV/4kKQrZ)`^'")f'Tri+OCtVp~$^`䷉ۤn7MkoC-%NFvꡇJHhZhNH9FJѡ9}QcI$FbL1*=*ʖmiȪS  *o_w̪Ey~w:s'QʚN%)Z75#)Kݻ!ՠSWlhUs[uw]M I3lSGLә_:tVuuiInF?UZKLPjsW/me*{ֺEͫ\DhP=Gn^hձ֫V/MW۷i㓁Vf0j(D9#SXZʹư[iEV4 n69V&uaGhUD;eZyEgQT 55p(۞6QJ+WhDhLQI`QZIyH[3'͠\@@FW2cwӊ`~BZ +B=-ymw&G*[-hie^X{qeQVll./Pe_3h4iݶz4c1RQt2V3޻,6˻Ԛ.pq\G0Z͢=~d"5;w3cR^͸G  #m q*8jIS>izoT۹>y;tV(fz]oQӮ4V9p*rV3*rpFS.Y+3:iteYNUVR*IZbY5T#s¬xb0gr$_β/.dylzW\iSF5jF[.]_S4JjM]N&FbI5 ,ȩ1orZ_|.yskmԷH;Z"+k=*Ιz}\*o+g"mB壷Er-?zuaJҿ3pq+[]vzyBcBW5FT:uX^Gs+2g=F)-mgh3j+U=Xʕ_wȿSMЯ`DtTNꗃۃO Y&z+N])6D۳sIܚmΉyqȊڭ3Y=YYZ-511W&-7VK+#e*pT52R z*U(Ω 7k)oH?_O26W& ? e(YJ8 oXMvєVBNI9+sw"G;=wim)bZ&a**ӕ8{af5x=<^&YK5bbxUe.XՊK~ht5P)=~Ѣ%Lcۀz}jFF zjZ+˲JX*O#2쒖 obF'OZ6SzR3 *MTDqLnH[dFʧ)<5ӌkJ.Wt#V])F<Wj#rGLѣ)>ɋy'U s1տ*/T_?xGJq<fT7ϟzOīL_?<"te͹bޞ¡l"U FR޲i ׋NDjϛ<}xTN&cݾޅ n^X2T~UelJ~/Q#TDǏZ'<ȶFE*փǏouZ_7-K#W*sד_}g_-ʭ;ˋ/q֋oQPIUJ.0Ҭ]7>޿ΫYXMy,ڰ;ǖI=)/hѦDa(Oo+ŧetmufso!X8~fv'MMm*SaQiWiiccK;աh"]^*JtcsTvv!֐!cq )6n( eLdd/;f:m_4E=#UE#Ft?~ڄcoԹĆ]V#"Vx'Ұ啋;jG߳F㝾n43ib"X ʦYG*]@WrVXj7f Ul͵֖}j!H 8:69llY_uZQ]-9Uֺ-.mRgYm9Uֺ- ]%ժvݣCﲣnm&7tEc4l9nJH 7ii$-WkuYE$J!b}N֪~<ۛ](*})[{DVXde؝=zM*#P&gB8:.%BRnN[8JgWѵH PYV):vE3[DY?ZK}6_Ŵɶ1w=j{ZȻx>?yi5{v? izq @y FY}IXa?& TBtSkuzs´u_~TҴ1gcOsWtZSͦŪ° eJ4eo 00*]_AҠMZuwfTmگ]ږ9"M?Vz[K|w3O8ú7ݻi54ZkTNMԫvO4;ؐUA?tJrO9)6':Ixv$B6Е5ymޙo&[Oulioib,Y)+?SV|օ.V+kr9}|{wjejǴ?_Z Elr?Mf}CDm))|Y!UKXId;#+88QS-71ب#^O^LMЗNчxmuu5lEi&N^MkmWQ+ʬ4C NZRW-C3kurn}WPr8S{hqi1oMz{[)8`)?ҝ7)>f2}:&k{8"@R[*FZfj^twI$S9-NcW$.;]J9pW0up4Sd"_6zcw4kk{H"FҤʑ*-QmPybYcBU R%rWc㚱fX[WV xmioăXZ(k2e[v׉:NGMzRJ1o]~?AJUbGO5>\ SohtMlio~G]KJcst( 0[Ch2LC3O8 &m3LG]AWM<\Q^Y+_K4g1HFGMӠOFa]'QޝZ1ջ[uj'Q)F:EnWh-R\gm2?*IM&C~#PLM.܏5]>-.pXO uȶv}bi%n(,\{V%QqI9%nxG ks%s44GPOezeM^ӖNk4id^sOɑd񳚒+m߹'|\䚷+0mݳ3^A{-wֵ/m{QU#j3_o_H$ݤSe'vj׈Mwr|?7:0rm|9_<akjou 5gU#bҗ_j :=vaҭKKI m_,!^k(,(( ( oEXxu5<^ Ix\GO_N穂t=SWӸ$0~"2rRМuCjŵҰ !޾j=SXTAm WQ18(cy_ysF 8ä㮞X>nS)k~9 ȭ *69I?v5^k~g[?4UE?N)EZH'Tnw~.Lqpy~Lhc`N>ʗYKM<,F78*]e-4 2NR<}in.9+V8mF;#,xNG29fi6O :/G_5ӜcëS1تspo#[h}jw,M:iZft=)Vg+:Ox?]l><gQEMejw 2*NO\wg>XQR۵̦4*#7??ҡ{(FUi{)5Pqi&EEMil-"*q>3PET((((((PC0X@H>s*s(nUİ$װeMꌬNܑ}QEAEQEbsl3gn~T %>XTviǻf#g3TU袊EQEQEVmF6|wvg?g8ױtZ AоO?{}Z~rV\=k2%&S,;pۈx38[|PN3uu)A>Dc7:q|OJ./gFoс]'ETL#V õ``0 KO+ 6 &]2BI>QE>Y64NBEQEI<[L̛zGMŠ|<4RG^{S(&eݞ5XtQtOVT *i$j$9ڣGQEAEQEPEQEPEQE*fUQNM+E"t;Y} >Wk )UK0U$ Y#hh]/()mQEQ@QEQ@QEQ@QEQ@QJr޺V*Ն0lual*C%OOoҫW~ '"_Nx߿,oߖ?[L'@(TK UR7  IcI>Q\ud_[VMܭ@I'$EQEsEQZ'<g7|1rZQ繓UJ5x=´<g<_d|1U*?+3P} Je%Hڼj3s3ƥ?g8˳)n*-A17 Jq /LZMrWjRZI?J;2&^\zVmγ!1W5`ċƁA<n洨^I)qRimC#F㺜u,cNyvmrs})5Vzf1\1:U]! ~clJBId ق.K$FBx*Mi4uӨ֟,jKol$cmo+*PĨ2L6wp"\ A" nNh霌km9cf2e7Oeuqp14 3gcK#FHIs֏(6{?w/ۨ/Z252m-4:׫/u-5X݄Qtϥfq43Jby";"#;LRx\V#ĞIUHZX(`./TtG TƸ;q\4I]V'$^2*5ԥW7LVp%uw}?&\11ܵWw/cMpSݶwn(=lKookbŘ$}vms)DUxʦ@N4) yvDE֧vvSB`N+6kgcS(ki^BV1AҶMX._$b>Y=ȹld5>Y\afpOT [wcS)%Yey6VwRy[!_&[x>lsUw(RC ~kB*LR UCY>k,kk[kߞu_&ߞ37ZU{Sv,W^*{ V ۅ:]ѷC1GUeW`zk[K1p,rEfDxz$*9t Yp? oq='P4٦y HuԨƚ_Fr%M_סyqiS\,(Q(2&;=<7ϖFd p -&}J1%2)&Y2M#HHIm уG썈dS?7:)HȲD쎿uXj;iKzfCY㧝e0х99f2I D$~Kϛ:)HȲDNUYyZIRj3'MQY&+vǩ)l8-:T޶w9>Jo]BYYIYU!A*Nͪ4wnKɤGhtlP^oHE|EɌIn-u$*m#dzK{Tl4I]۫15~{Ow+CZevӳȭZ2feU$$ zoq5F*qMGC$՘$Ҿ$N6/TVP*Yg#Iy1 sTe>֩*94|C4j#Q*Yg#IewX1QWO{˞=(ҲTD )g`n9FY*;<]160€ٜsY@UJ'+*9e1bi"1ߺH4)$V&3=o{/Fuc'ѿ쎂C}d@"6ٻ?\ I{±,ȥs+ڳC+aq0MXӮ $4)'*sUCkϙV+sҦ;=h&xcV$8Ywmy68"i"VjcJ|6_][(Jwk_ʼnFynveHa9\tm;]"hwo1[$tRr01;'䩞go-Ů~4gjwOZ.RHΝK$ڼI G\GIec5,jeiI [ Iԩ F1n-HJ1wwhX7egST.3׎qލfY%nV$$0n#vgf9$jYeR8{soms5h0yeVvmNv/URW+ÚE<|vov2WXWsQN/;^RjP.e5立sBv}ߕ9jU!]8;ךe>,f z}*4UeRQXa֦%{"bo1о9+3V,t<͹v[÷FSdjr(R(ڡ\ STWSpԄW,J:et2#?Mku=&J[P~,x;zYjAI!rp )US(ªvڳI$xI*.$\ gN0%r?vZGma\ݞk~r\S> .AWa͉_jWu 6p)"d2֡I!T/'C)vߥrU\SiՏuy5:VPFϱuF6d2bRT׃ T5JS֒ (( (( (( (( (( (( (( (( (( (( (( (( (( (( (5m ĀҨP{Z<5*Wq,'9V дc@>cUeEɋEWj`#oqӚ\NcG ?gR_{Įj{:[(gHGUFeA!GRD2mMUm[XJΦsVizux[wʮuVg[-4I,ʿSTdbHd+`WȍͦPqF4+ssS<>:ҍ$7b__ I8XU}q:V8Z_3 GL-! I8V'n am~P}j!*YNkxY,>e+og\_,\nmu }y 2j3$, V  ;:dm9>Zm|y}x`D芑2dQ N8Τ7vnzv,u'9w̩0>ty|nQVDR"B=y5'Te.դR˷ LH"s^yGF_yY5~n_ȣ.RZU.qӯ؄ENyZТu}%>( 9&WG)IFrmNN4Rԣ9]6]uB(Um0I?IwP95npE9-`pr }cZzLzD߈_*9~>|朶 sV (@#ƿU{tyenOZ4V^JPM][)=Z5ix9S77wc#̭iH a4/SM+)oZrh֒֊0(((((((((((((((((((((((((((((V>nnk2,|0'= -G 2h?g0T zֳc'ig9i֘oGa,_f(YQduuxfn4dbcbM8X7HA^<9h|M}*eN~KNPT{ s9,ExVWZگ_a>x}kYWs4FmCVu?"(whV+]Za>,|:OvJn$?:iR:en֘׋XM^1<[i7ZJ+hޏZiSp}i ֡C0&+]}Z aL剓3x0*GlKI\қ)QEQP@QEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEpjUiUUrrQ[0\jȻ`iyb\Q K 3EןS c'hxŠ(sxQM'j!!+HݟS qu. (HnORɤOdVQE[7֚g>[4TFO; (4}j)ss0*_4y֣3QE֍֛Eap)wL( (ɣ4Q@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@Q_ endstream endobj 80 0 obj 19449 endobj 15 0 obj << /BitsPerComponent 8 /Height 116 /Width 457 /Length 81 0 R /Filter /DCTDecode /Type /XObject /ColorSpace /DeviceCMYK /Subtype /Image >> stream JFIFAdobeeC 4"@.0&4KBONJBIHS^xeSXqZHIhiq{QdxC=""=VIVt"" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz?㨢:(((((((((((((((((((((((((t;R"EF_>~-6khEW;Et_ŷMgj+<ŮYQEQE}5Z4qg(ѣ8EQE+Ln؉_ec(}^/Š((S(((((((((((((((((((((((((gXb;S*ݾ\Lrv_R̪Kz촫}}=ue} *c (_6+OGsz vfjz>['%;T=BmJ'd_J<7noԆ2[+l澸X-s}z[GMFKHг5Q]ރǥm8iߙeɄʽNW(ZtJɷQ2YzCg dQNG]ZtbN֙7anQErz."E43%GYxO-a2gZdk I%7};j.Sx<$^?z规I݀QE/]oϘK/҆"/((,hRUo??`2jy((_)SO?mw>W1Z&~nEQEWQEWYb{..R.pv)|EfYQXHz+>i{YY+\(J( ((h˪/#GJ9^ҕ)U7`QEdQ]O6O) |=1YSEQEW8QEQ@QEQ@QET]ΰ[^F袜b۲**+(egoG{|;;QaK19ֽeu (( (( ((L2h)d#PiD(^b펧aWr+k\դ.r'>vVi,@'޳_^|^EF}w`QEqu*/Rx>ti:vho,+Ԁ;ghSX.?y,."*]+67Z켌? Xo%c2#O<~=k?g%y#+;DڽC'v5 ZE=|(m,uIHVd \6I[+WkCg-y#+c7|?+҇,ƠW=x1iЄQZjz̊^u$?n^8o]'V83I[^(XV%ħ?z"M?aVm+J{]5IJ:}Kw<9-4,bF!R7solZ?S¼^Vs&r/xNJ QT( (!mh!\4[?pEYQ^iZS9/EVW<u?UM{6.Us5eSEQE[Am e\o݅=4kma(hɼhW乙Ok>WP{YRp?Z.A_(vWF:e8*F4icK3+t(U,ʪ $޽ Ac,w_d?"NݫpNT(dfI]#Ep+&\D4扨{82O玵\7ٳ$3NR~-(NTܜgҒ!|&1$*mnĒ,PW+cZm{P ((x>f ~\~X kCJ`mۅ `a(EV]wMo5G]Q MvQ֬EW'Eu7^*nn"?j[Y 1ȇMMl-ZlETtQE`EQE]oo|ּ^e̷PU-K Z (變ݢddMb]YK\7J6* +NƏ*K(ڎ>2Cq;.sS*#gQUh.s abB?S$N8zWEV=x9wtH?m%·*t-J7+]ieR&]G+\)N&((m..m dhCVN1Q?-QEEl,y^ ۙƺ)`+Wt+Bw%tI_W3<LD8*k*j>8(QEQEQ^_{R¨Ǖ6ݵ{X N/ʖ(۶{(("ѭ~A Ҽ_&.<}QEQEz8\2*ޖ>wr8-ihם_QEf+q8Sq n([m#E]r tkhS|UK7p*:[J!i E8?:I&}z%Pĸ7Q^wϓb W|W/EQ\N^Ǫuln$tkm ~BpjxZmEQEx:Vؿ+Cþ7n'Bj0ꚁiA0FwH}OkPTUpXSkQEE1q"(ªTu:ъMuW1Kq+ٹKu;KV،S|c{QEpwh)_+JR$td `'V~ΤwEUhynp&.#\gGNO,JHMu:Ks*Hʣ58SՍ~[p (5YYr ʫ!W=M;vO\yZdp)g0XBڰQS(UPPoFAUo5+h?Z˧W7_-8QEꑺH՗Nj{cnSS+ά/t=[+д,"U۸r#uaqiӔuEUP _k|~:ne[{ifo?P5; et#ՀQEİ[ }(IEr>&f[s'#R}w+SQ]<׶l0}š)b0ȎI9'&'s4:p˗*ۦs^mΤ`+eWB 7֬T>SȯI N ˆW.eQEl&e$s#_뤪Z-4hqO:z]?,ikP (kQ}I2+ygϢ05׷7ҙ.eg=W*uxأ)ʕ8"g (Je`Y.$cZ̷zEs#)j/Gb9+a[(<+((6QS%FOs`5?Ti=((H~ga#ʛ7хQGj(_ ?v csiapI{V@(+W^\$>zzRM0*ƟnnOӽzh@#nf+9<]p2k)rs# +fq<ےجO]Cg7T^q>r{~V|F"s)Ep (j?h?:(SHʃ5Q&( {I$c-4W@y?UkI *(U¹n!sqOazQEnxjlxF>yGUv֖ o;([V~߻qW!p+T߰QEQEQEx&"ڌcHH\HU'@ޚt8 Jw?>^[Eԯ:QE^vGE»=~t.YĎ6G5x.rXc?kǵV: EWm\GOJOQ\.>[kU=s#ZWhň沫( `BߏA'djMa5G&ǓT3½/> ϫ (brrhhֿkm#*\tr| %(Gm] }O&XPl[C4[Nz7iDCUt:7G_(|Q5+~߹BV6+)5K;3rk7]@ (((WCB؊mmsŠ>laNDi>_(G>QE⻏(Ҳ?fԈT^7~#F|9m]wǟq0 (ζv4-WK#K+H,>oHO3Oj#OP (m_pGm_\w^4q!4[?s崹QEnW$Yfb+֮~ɤB<\FK,1}[5{Z (Zisj[~k[w*v~jT;(I"ƃ,({_Pr~?\WJ8u+mm!~h ϕEl$|WC\'|\ħ~=O&ac@ ((U=;_ܺSs{;QEQ_oV,uu_֧ezK_y|>EQEW7a4WGJCw?((Š(((vV$s+ZZ4AlڿStoic#?`-bp?}DٰV ((\(|'mQ,*\![l]/uـ+| (j\}YVؿEus8~Bf,y$ץaOEW+u:A{⛮)YRh>{Y:\$:\Au o"p{9ok5QE7:UQ?ZLeڿIǧ(qX2rVY*O5<[ꑠ'Ru-9(i;DZcY$?,JxSZPSt`QE?4>Z|miM1W$u5m4{|`\YblD˧ETZ4A_:zmq e<uyNjܟʀ(uy|!o?vʰ[+}б`*ӥ#_x$) pk>w(YY^F9gbiU"zYҾr1s݀QEdҭ۴`kǙn<]yqRlYG3(V*tu=F_sUxR,LW )2ǧ+)sOu*qM:y+!1hʏk_w>Vf~G+qJL]e>Տb (N wE&kf9FQm^S!&Qzq+F)ciE0 (E ڣD-D[v ԄNG\4t-(tX4_N搏{VVTq'̿w'5%mk,cBߐZNEW xNCJ/q5""*\?7:ٝ>]dYhΫL('w>n ~XcyX~Wk.'C+Ujq=YO)Q ;@Om!zF Vi֭ԮV3_udTQEe]Jo'I3Oq5koXGoan-l`5_ƴ~:#QEsM&`pB_:zmsO.J+5[@(+E..#S9?F#Cm my4eTs(QW$u6v8TRMyqu,G-0һQEQE~sZTu&Z7RnQEQYQEQ@QSyu/˙z3POS({QEQE(*Wp"XS~ET]\Jd TQCmEQR\jx-QE$Օv?X* gR]ISFU(()QnTqZj/E\*N h(n.g`<88QWa-$n/.-ĒN* *IEQSMap'** \5d+BmsSD*Ϣs'p (RXR(H*E>AWJrETW7s3W=* (rw`QE:)WyVS+f@#> stream JFIFAdobeeC 4"@.0&4KBONJBIHS^xeSXqZHIhiq{QdxC=""=VIV"" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz?4 p<4QERO/@ (P)E2 (q*p?) (D*pU8S) )BGN  eQE(UL(ؿ_ʔ*t~T QL( 8*t~T*AEP?*pU8S)Q@UWZAESE9U)AKIE9U)Wi™hZ(N *hZ(K(H--%-WKER) J))EWKE2ТRSWN*yUij챣;$WϨp NڲWM8R>')/jZPTg=/kd\篕g?:lmt̋}>q<64ȱƝXtp\[_mսu@MMw:.RrNEom-!BuߟZ$qȅ$Et=U"{aۂ?/.mmo>F>:^eGo%uE8x5\q:o]恦. ݚ]?J5L̋|w;WITdWBH"RZ7a0|ԭ~D m8Uy!h꾵4s+Խzז[#?n4`w?Տ^lYʌ94TGttVΏۍAViI#aΟo7m?tz}=k*`]X|7:ǭe}_$PK[Of60#wiF>?*DH""ٌVdj$Gl=Z?v'<3J,QO:TO: ɨZ.4 u,[l ߘS…˧9lrasC}nOOxn`IdT]h5>/QPtRTC.TW4nQԣ)Ti+>P5 V{:|:JTwZv"GpZJs+}k>(0AQEQ/'ciNRxRz7YUBN5VTgt$~T:lŎ<(c'r  O»>FOČ~Er~5_B}`CI50ѩ/U9Wdvhr}EWsQEyQEQEQEQEQEQEQEQEQEQEQE)š)µ=DQE8S4S2QE)(Z ()š)™h(U h e )œ))( ppR ()E%(Z ()š)¨QE( h e)E8SE8S)QN妊r4AES֜)NBE)*BER"д(EiE%(*BpӅ`&>x{k#fc*]u^l$M;Y/RE%kg__o e3i-$Ǩw)_ZgJ$Qԩ+$vgiVw1^Zq r.GcxB76hQ^ؚ^*Q:<+ҍJZ\# ީ*JPWw̽qkgUO|}as$2卣uꬸ"\:zE;G[x|u;XJ ըH +}aϬ?rTmț գ ըh5gx!U*֓!k/){INQdxc\{+v<cӌ-+gé,Laz,ddkQn-C'JKtTVycFenRj_kE."#R:g?T(SЮ.u)MC );G@+6KmfșFIiSVe/~T>Vg]\js5C );G@+2[mjșFRDU +[Um9=j?[]3dufK+[Um Z/Tb+;Gj_?c˺3U9(8Vg1ǿԿڿSE{z}Š(AJ+/[j_shQZ+'`Ͽ?֣dϿ?֧&p+aiEchϿ?֥?kKQE)±j_>Zx=0+lSaoԿ}?i.( ??Կȟj~,eQE)¹/tȟ/$?~X0+\$?_I"4;?aEWB)¹I"4ӗEiXw)c0+orȿ(W8_Ɵr?߃ +Zp`x/cK g8_ƟraoRfN)¹K"4]N)f8oRfԊZ/aN)f8_ԻoL?#4aP{z}YCEG_3ꨮWoƗoƟ)w)fxOSEU\tuuʜy;v K C7cA#OMJjG N/"jh<Z_?ֲfM*RuS]Aym"9ۡn6{9]eyλ!kksk1mqXjqJ,11N?2z/ԿhcXb}kSNCHѫA^Txc-f1ڏIԗN3nYTT?#Rꖗ Z\;c)^ݭ^?U55v8V?Wlnxa(u5R FYAIݛ޶lnNQ>j ͷ#giWׂ0v֖+/Iϙ }tLqpnO|V&8'Raur};)/^%InGٚooǕaJݷ,Z˧Y$wO?5s@ͨÜfǸzǫVcBuReJ/o&J̹ڔ6fǸzƫz}؅д]q=thӣܰw+mrjʺ|O[Zbr T&<" ?mӦGi<\۰Tzc+xRg{yY)ʟ$],u:{t inXZf]v 䫧DU'!Bیӥgͨ4ruPqY@HͻG1ҬkL=!OJ أK[TztZ a. Ɣ|mgEKYFֳ"׈TK8ڨ:D6a./l_iQқ'P a. {Ծ*V1vD~&]2mfn=OXz^sam߸ر_qh7Vѵo/Aԩ&m[țœ;&'dHW2jyzfG۹S?{|>_(ۜbM\o>>Ïwۏ[_/U.dZL?z_o]7͛uf˭%w>N7)}fEϙQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQE\mQϟ YCO'ҶjJ͊S򱷯_zҚN4 <ڙRANF"d1dg]$䪿k7ʲy봷~4wZ:4P[E`w''zJG jiyᇌ{_y`cGW H<^\+ty*+w=ҬhdK<[*?TW:\A,n )ʅ*T}:Z&TI4̸%oӚ iƖ/{U '8\pI4݁sJ̏'o9nAМl+YhjcwU=)ݼV0rq1ִmty9-H"2rW0\Y>Addq*JkwhGZ?>U{[zSՓ(ĐTcn)JE$n1ǺcOIvD,8V#+Mڤ*p'T^&Ԝ>_xQ:xx7]!_;.eOO鹢!R=ydr=2zɏ~ǮvJ8RiQjޛsf" w*4/*H0J+{ m_j sD$c-&ҤuRh' lXıƋ`Q8B? 1F.黫##(9qM Zrg K|0)c:\*mLEF<΁?1w9 VIiM$?$G[f޾QE}jW Qpkz7|=T"{;==*u4anxđ.\g!jI<;y{zP}j7ˆ(5^ 2yIwk$Lj6j[ ln#q*v vx$!Evo}^+Ji$m$cEEXR{Ǯ;Rgqx_'}:jW%bOK$Nqnk5EqǞՖݮnKxE-Iޫ]sO &7#i#ZahI+44<W}*g(sy'o^}гl[x2dQ'MJ)!LV|˷*ǿ\VN4ަҧn5 &zdi mzbbg9^sVHu,3A$=zCLn btG$V1pҥ6Hec(KKb]3lu?O,6΅e׭#9^ARq4_CϯJQHbyY@|#W:EլR<bYHg}!,eո)}$,v"%*հLLv%<R?\)?4l:Ҙ(91@eSA?Ұ=] SW՗/Wf~\'?V|oe",s֊vIUj(9Ģ(((((((((((((((((((((((((((((((((((((((((((((((6ftyd 2H<Iե FG&Yd2l ltiьe+H*͝GIR# 4䚭ZztblxefC.|V#W#-gK|ϺE7>~ϲMnY=kYg6,.;vjݿT+V7t΅]NQ.i1km(9F4VR$chZE\Re FGpž60e{&v[Iu:A]͞& 2[C3'M?zM+kWL-"v1,0Dd{iO#-鶫@'h$XOG(vumO,bk{L'qʐWcȞ[m܍ʜFqS^i/*ԣ_Jirva=5<щoMr22*B^$~[ލFq*dq:jO:dq Cs<[WuK..Hڰ#N܏T)3Ire{y_{,TU +詸y_oǩRSq~ˍ.[v$EH6 G0}7_Ɂڽ[W[.˒0$eS#1P-іKydgV2zU"6oJ*1[D%TEL?cOG/m%N84Ubic,J)^;>п桢+(((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((*֟wg4c9UF[IU:4{ h r?V}_kOKi#= v6T]V }?gG?:N"!9Vt֟jX695.=*VWNk? `wz9n88(mmgʷszTWK$QۖxA_4BI+-4-cT֖JbszT7,Q3˒27GJ }T9/E+F 2#WM+x KO&l@1x9v"Δ_21S\ݪsQEACEQE^uDZFzUs恣j&wZ?=sޫMV=|QNXUx|sTh6z}dqK.y @Pq2?.J7nWoAR3gja+ץUSASپ໹*>C&}Zʨ?NKb%)󍴆6 iT蚕&YYc^J߮T)8)|^h4N%xEhàD$K6zneSiW)d+C3|ܜQJ*1RB*QH((h,ڶqUjKm)h7_aZJHGQizJiEV&dEU5nmQ#$ N?h"^B)7[DtSYXsUrj&FI-`;J?jHƥQ}BI kh݅M9o!Ns"Btq,qgcTw5r-QCɹFN/jeĺ[f8sOo"'e}qҟfK7Beխ?u1*K"/6{fHV0\ttQEdfR(?~ Ms5KłKyV9W#?_k.}/k 9|2\]FgS@1ڬZ֝o";x9|ǥ|R=w_3Yfn׫J">R}ͧBDcYZ:ޛo4+oqo<VN,b3 bzrK!?'?f"3L'-n&?;n<.FxJwʷ.>Կ8dr^ mQ1lꤩ5^+wvk%#E8ҭ-?PK.Ž qygM*+ |Ҟ4^Kum#ZZMe-`\`4}Ht`KBkYP|ȌxGUo`lɻY?LzrכzRuwjXY64AG*iV4~ uBz2~WOݶC&/`s= KƖERBr͌~>܇=Sj aqdX|ުz\IXU$l awcc՝2_r>[r=W+Jc[٫] TdzR,c 6ޕ^6vEb*mH{r*uYu(%[S,;~ul򗖗Aʻ`-rOJ=]U=Ovq+)~dM48: Qކ%bT*'f#^?jϗRP ʎDH|~}^T׻W;1V%Q[@_ rj#nyㅡmkT\ >؁Ot(aфe{6O9qj h/#T6$XYo?^դcQI=PBY{;kI9 }1=pis[T95[SKa}*2%U^GccS&R}Siݜ 3ىBť$-j ''9uEo@R>7kpPA9㊇&laud2]vM3oO)kTJ.1.=j{B];#)#;~\gPڬGBycn|-<3բKk cQsM{XmaʴV2j?uE[+9H\ m=sDTy#\#"u\zgnjlլ1L#9զЦyȵ'!vX $Kk[ۛ^\.=ӪieXКג !n+Jm;$Hj)Jj7Mo]i_15'rIFmZl@R۹[<>O^*|'Fu'ʫ^dZߵoBZ\J.>VsW2++sM=TZG[팯<)/P;WXbN"Q^d7*ׇm5+.ljwMlcQJs P,azۉ{RI3o!NX]+c֝q*kH&FN=H? F47?OuihKuyYv7r'ړC웶" Wz{Us/oou9-IDPn&FXDLjV>$YvOq/֖/Zi%1DەJm;)6mذAjq%?#OR5޷[Ƥi?y(gs7I㏿e赫v$h';;r9R?* ;}?AU7{on1_~t{ TGnT*s*̊TQR&U9:\ $`]OoQhZLzVۍ9› _n>L>STRWoxjjJu*|-_JK(uE .ݿG~Z/+n69 goK&EwսG7EuتsS֢Ԭ)m6̘+" {kNڄ"JwI66=\]؈c! 5+_ Tc9NK-^#%1Uݎ5ũجRm0VEn֥߇mu$rjR{sT5}"[[G_y;=IWhZF4|-7Wf8))Bq]Z_]mp6OǸm<;\]#=9)a]ϭ͢MR+sBf᯶$Jʪ=~_Tt^d))Bq]j:WMlp6'r6Jv}݇=9u[(Ac4@**?{Ԫي~])xOO~FOw+gV*û'%R*칖߉c'B*? xX{R7<~$|Eda$O~FOBf/)|͘;YxsUk{|j5UhGG{zGiKlݷ5SZΡ4ed7)^>ȟzJoMI$=qV5Wf'Tǽ"(ITzjUKBW_ endstream endobj 82 0 obj 16709 endobj 17 0 obj << /Length 83 0 R /Filter /FlateDecode >> stream X 1 @`ѯKBJD&+jb*\jiYIލloρ 8[;G&&E endstream endobj 83 0 obj 92 endobj 18 0 obj [ /Indexed /DeviceCMYK 16 17 0 R ] endobj 19 0 obj << /BitsPerComponent 8 /Height 32 /Width 155 /Length 84 0 R /Filter /FlateDecode /Type /XObject /ColorSpace 18 0 R /Subtype /Image >> stream XWv0 4K%ޑ1HƤOy@*hڌ<3z_.%  #|J ~:5y {'ӐWKA6hWr9ڂJ*DAZ@ K zO864`%}!(sט)5T(b~%zK[N=/;s6́ZBw q^"fq鴷h?P53FOJO.pkٸ0c.LPTt'_muw΢K%(FغmM3#xy;gѹl 5/ݱus1H$z9<^< !9(zϘT\8lTԷYoqVyR.1E{ZZn笭VAv`5y$JtP483bV'*ԗ|{-T9B1$0 SR|!?_!G endstream endobj 84 0 obj 731 endobj 20 0 obj << /BitsPerComponent 8 /Height 201 /Width 292 /Length 85 0 R /Filter /DCTDecode /Type /XObject /ColorSpace /DeviceCMYK /Subtype /Image >> stream JFIFAdobeeC 4"@.0&4KBONJBIHS^xeSXqZHIhiq{QdxC=""=VIV$"" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz?㨢Š(((((((((((((((((((((((((+ON.F_u9<ZR:Ekƹ\20Oj̢**J荽zZmCVvE6g7t1(%JuQE (( (( (( (( (( (( (( (( (( (( (( (( (( (( ((:]{c׫9M]1m!EFWɺEx,:u{ DDPZ 3M>e> ~ZRYWu*_#UJ0ȽYڞi++$?էl+X+1rvQEPu5OeQ?ATjݎs{Fiv8PhCccbΗ?Qj<ʡx#BHQQoԿTu=^LQ4\j0}#˟迯ֹ%Wgwff9bNI>XKM7M]8j R{uk<148c_wJ<)Mvj-vg?VW;$' ~_eczcwZ@&v2/;E_9c=+oN+k,,J%lاsg.|ai"y$ֱhťۻ*z:YԦkٝCEk<>N~(AEQEPEQEPEQEPEQEPEQEPEQEPEQEPEQE$Kq GO(-ĩkLqQvS9H!q¨H{keI/g'* >?6}N8X-dh07֮]NCZkBN̻cSݾs:zʹ+i$i$c)i{YXwOoJYuoU/BIK7 1?)O5J)/jf:][R̭k߀ 呤ݎYMؿ,IiX(\坙vU"9T_,^$[ޫ=\K^査((Ϡ)HV,¿+~E&yr0m#%9-98Sh08PgwŠK3gb kuƯYU ^NO&,R! [l{v?xoZjmNR$=}jRHU'+1f,$j֗$P^$0U\rGA5[_";S5R47F$Q =}99Eӭr ޲a79#t%{ɞgP[o۹\e'? \QV][g_6~Zw-1ʕӌwS&w!'X8 YUCFU_擎;]%(wj6H*QsW+gg\xKPsq"v5M,fgbIM2 3M gyNH\(>Ӆ_ZF }#$~=k',ǚ9z2!%jYjPQϸꮼkr(Tvc]WeYB^?\ ΢FFwZz\\b5J5TAQNA rcǑeuJR\v!8>&1cj_wtpKW9q3Hrr}:(ŭv[¸5 %QER(((((((((((TVvTE,UFI4QE#2fUU$))cFFU&-t9^3%܂(`+pvq\v]j2$U~ꏕW㚯m2/~o?ʬIAk%E˛.. :r֞0hǗϩzR_>U X/u;O6Q͸n6UV%XOsISM3ŤrIr}*x\CmP?kdca2F%^{.F{PoAϭ'N=:q,=mch ݾ2UF>w&)zJ>PP&>#(S?cWyEJ+kB&%>$[kg. /$Է+T1J%Mo/s\iQQz%_*$|)YcAqPG,I%X˂0۝) T.;oN3H(Gvƌo͂yj{V3;R:DIlj}fm]LZA+(],n߉ Etg?_UkPu?r6%~ZZ0xv%i^oaym {Pusy~MR0*zcueyX5VD}E?#'Vk+W_iZb k,O,c߅tS÷*5&ވ(]_ihN q߭q,?2B>CmJ}ˬ1#ڮ-ݖ,V~C?ӥg\j\u'o`*e$5zQϩ|_3[ch;e7"s5-nQl)1ʋmfk#U"y: qSE Gʪ9.U>i{G bqow嘓INHԩ >mOSPT{$Zy?Dce|*W}XL Wj̅PGJ]{~51\yHϖU;hVB ,eOn­Aj Ao,nkW\ڮa_R ? Ɋ3ɔG/v}[ XCVvr s[pr V젚nt2f)4w\V=!JRנQT-ZMībN\gWWOUot;]6GvNH#v>dZ ~)7JÕ>Iy,ZB?ultՒ=KlK>koT ]3O#4>ƃIF)0ީRKLc{wy8Q1&qeOʝ~qpۼ#h\̏1''&u^Xkf9#Ub}zKx Cϫw?R[;)fw ,I$䚚/"qU|Krh[ >OZTxv]1[I5W/^3pVl vq^\YY,eY"B*ޫEe(( (( (( (t\|CX"Ao=zKkjRcj-:.SVߘV/5c0@Pܲ jYyUs$'}O8fFX'I4PX-AHP{Vcʬw֑rL`.Kv(%$:g6:Oo+ghm!7,ǩ'@%%Þ*yHpZ?+±֢-g5)E{m.N!I aLPZg֧Ib3znAV,"PfWŔZ 41y5s)7g1wm|l#?LQG_/fW!rOjwҫU֊O!gV^V<->ja0ҍ@_O_ƹT qRn_+Hgo#x^ė /$݃>(tGkg*>O,_mj܃ &׬\Qt?ƏH}\uq_G_#k}G?z?&3!KuK4nƹw1/~?/6&ԿƏIC|Nhr_?Ə:M???F$ڏ?G$ڏ?XN}Mt_۲Ͽ>K/ƹīcҒŘ+=!g?6$q*G$'8h=MtϷ>G;@ܞ)! M?kmE?4:P?zɣ'Mt?۳ϷD_ݛ}Y3&IhA?P?'?V&IR-jN C ' }iRIS\X5u,NE}Q̞%j!$*)TJ8 5a]#R./5R)kR B9^ƲFx֪=JUOT_WqzWO_UV_Uba-zQiZB R:cZ`=zgjk mȪv buʏ?qէiONۚCUXn`?+_'y n:lQЂOzGS+$ǡEbkQEQEQEQE,h:.Y(GHgsI'VŻ=,"_Yrs9w儌>On]z ]ڂ=fTS(xsY${b[[}aM\rܨ>\rqLNU~𤰘Go6>p+[~78$EM( QEF!팦ўjr#4ȅT O&|ˌ*C0.3x')OJq8%sBdS6c o vm8Mb6}C,msaOS,jK/\+|>cʫl0w*Hi *pWx&mŶp FUfXP GRV-;ϽM|tgr>[OFp*SAF>ls֞Ki_saPi^*H7?Jk'R~T{xzf^1Jmɥ(+ 'Jn9\<JE%,`^4`V6UCYkKFQ2{'̞oO@i2@U.*&ަ$X798W¶S1NN z3J'xm?jF=G4m5Zlωiu3c—\|ϒ ?wd%YN XtPT*AR8 ӌ(RO (((RݘUI'5 Z`&s),вRvehۘI"0UN}SR3Y6= )=Ydv+0_*<徴}p4!Lo_kZjNb#T9C[Ěe;QՎ#FS% ˵Gezr6[?9d&''GMl$ 󜎔C=3Zң%[3z4jc/jj]4N&oldN0A& vUrOZj04V޾L >X66A*H=EH2?T<.r>=QB;lt ׊с'R,s#w?dN*sjҕHT׷R6Rd U;zqLrxtlV70۳cb8?8(vb3.8K򒬹{ ֎O|=M~\\z+#^1&s@r J=JkrGmb'V$_O488@R%W6Q=i{yeKmSf]^I?"H{9qNW{WWUirFhth֥Z6TB*)Zwo(UJ>*ȡ?x9+nݵ^ Y#JXRC|ۚF4dsQWX7D3y.G^pppiY IQ#*F'' )3!,O]*2KJ%P+J06 R{ t:Q*oe88Btsku!]`+xYjs\>w p?ڐ|"qLm@#ҧ]9M[-{ƎGG$|Ra@6*b ާ:C}*ҭIYnՋpD\=|)H-Y6Զ<)%P;GF't9VQ+gzu4VѸ)h(QEQ@Q[Q)/sg0qެi7e3^sޟwhrkwN3Zfr} Ŗ&Ui6?ΤzXk|A-%OIpoDVSVpW[M=tn䕣 Y?Wf>ʧ]<}OXTOze9 -I W2. &iACA6TZA/_!0K8F?4? >GW:yo5?_(1X֠`oʥƧZ2!Si= <Doݞ|~}f/_Zmn\_ZE¡e`w$ir8'?TSi|i2?̈ 4m'Sh?~yiTJH7?OdS#G)2Qd@Rm&yQE”_֠&Bv}iI]WuL0bAB2ŮX?̊XbxXX"A-WW!yRM9 TTf֔HG4z̊/E`U O꿭4??3Q`Jgjx)U( 25rD iU]5N#2ݽA , KAZl1$gԻX^V+q_ݏ5 (9&jjiʽҡZm40W+E\B{ K}pAXv}yѧIwj(Ö;=Ffw$ ? SX̑DUktM4iB"UcF^aT袊8EQEPEQEPEQZ6z5<Ȕ`7V_A+:u%M#]V6E4%b[[4VΖmzm bxث!SQEq4,)]CWƵ#Y@ ƺz4r즷,L?Z􉭠3#WUdžcH9ZwԛzStut/wl>Z^;)Ds N ],j&iUtg |ƙ??G~f]|=|/Q%i0qj]7RcN9R^kB1o Cx4:5KiZ0}Va|"fO/f)mjaj?Ϸ>U}V)u3-&?M?—-^6֧>Z4ͧ҅?_ΞwO85y?MEw_3/mkSQo}?Ə=G}`SB/R*')ᬇ emja?Ϸ>Q*g~tOvQ%OS d#_z)Ew2Ѷ?ij5CC=xc_z-r2vѶi7? R*MZp<ys|"ѢSmkit }/=uOt϶iOPy3(´\GCU)w0Gؤo^¡=J)-rJ+VWeOGg'UƇVtE{j]-q[> stream JFIFAdobeeC 4"@.0&4KBONJBIHS^xeSXqZHIhiq{QdxC=""=VIV"" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz?㨢:((((((((((((((((((((()BB傻*,QEh>a U]g/==6AaEQ6jQz=FP5=j7'/CqEH'WG B{0( !FN1ڊ)A+ҞF@ҡ=Eqfbp/S NOގAIEQEQEQEQEQEQ@Ӳ&0xR^;0xعR^ (7bIh Cߨ䏣Pk䂊3E)R:LP S84ʧ K]эNOÆ A84f\yAkdغ]w_?b2|] \.(%+jǖQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQER tס1i= YN>wQF(⍧ғ$J9\wb~ ewՏG(Pu#+QsK})Ph>xJ((5 2R45FUF7aERMW,>Jk^?F`hSZ}Xt(+ (({V(M3:iҏ4ڊ (RxTsa”g= v)M6Qz)(((VI_cWΗgt?2a.EEQErEQ@qɭ'^iSݛaNHҧ (P~QJ(pxJxJ1O?H)(ƕ?v((:(0hEЮ((aER#ޗ_Jm2>.>l~3,Ϻf%b\`F |6?/,>OzQIEWQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQE9%)/ֱ D)= QGjBsEWiB B+$QE2hU'zҒs<–߼֋yaG FQokDPh()O־()%Q<;EO??(p(4UG\*uC2*FGK!g#Qi~ (W%WTRI|J*jmh)s%*y5N`>";?ïQ@IE`N?N (E*Ԕ))_x~Z}q+.4P:IEW̟4QE8(SJ%E_ø5./(zEQ_R}HQES^h?*ޛ_ ;Vu ;VuR7qJ+9AEٟ7vaESRy}) 4d׷ϱ=ڞ|y"SޏRQESkpx8|˪> IQNSȧEҟ_+&>u(aRWu)spC:98KuQAEQEAEQEPEQEPEQEPEQEPEQEPEQEPEQEPEQEPEQEPEQEPEQEPEQJO )(5<9xr7Iuh(=(p)q6'oʥiO[TR'l ֒((^N) ɥ_֒Æju%ݯԗvp(FHPZ䃗cjK]QJ&֔ Y?6~Y (R'ɯw P0?iO]ࢗIKRGk.ik9qM|斱PCi)O.h}][a) vSʩ))W >s9[xs9[x SJ(4-~x~xQE))(<+ C Ndh 5:}QE*RR\/VQ˛ w~z(=h((((()O##% q] luHwGn<eR;u]Qފ()GJ*+gT0p]QARQ|-ZQ'Z%ZNxQEb'o+'3'0c(ʑsڒKjz%og(ފ)Bw#ÚsazN/4K QEI_/Vө4|Z3' AEQEVfaEQEPEQEPEQEPEQEPEQEPEQEPEQEPEQJG9))Oɋ_x~&3Z@ԔQE}aERJS>ԇ?2XaEQEW!QE*㿡49a$$}FI?? 4QE){׭vc]_tCJN8 RWp*J>*;zEQEWٟdQEN9LNxOyXP9r%.px#NJt_wxn5)e (i5f}+I0(=h^TE_bVJ/b '_ ((E~j5;֊dJz4+xK:+Ī|&(+䏒 (( (( (( (( ()FΔ|4.Oy\UE (+O ()v}ڼm?<]W>1ь?%tࢊ( 6ps\2,}cS喏(iϱ8jZE?=a:U(f(0 ((ہ=Zϖ[~Fpk>ZQmQJ)A)VՠjEuh>Zq (QEQEQEQEQE < i6+肊(qھE{Tr ]Hs;GɞR (M*} jƍ ~2_q~6}EhiQE~~QE*4֒#rb#Q}>#rb#Q}P((>x(CEW z2ĽXQERzJzl%O1JP;E.piJT2Gz,cW&<cW&(Ҋ(*@SJTG֓4WK__ݥ J#R'#W1vn%aQo~ (RQGNWERR ]AҒ?9bUu,|*rX(JSM#&[6684`߽ @U8JiփR7=JiփR7 (R %k|9?>[Û /0ǧ4QFs֒v+|#_ V?sq:gV?pz)(PⱧJu aNsvnQ@1EK%مQE*N%(MoZc՛0ZՅhJJ(iӍ(FVH68Rad(B3HkŧZOl1iV/ (EQE|aESf{JPq^Y5Nz#3zFX~^ER:RWR SYTBQEJGzJU+8,Uhz;gGU%Q_QE8(鴬;n!3 (C?ax(%jө޵ uԍg=ho4)8k3' KOWAK((()M%/Tq^Qs+# Rk|\*Fi.LG@;QEWEQEPEQEPEQ@(\ȣ?J+g:~>_PRi(@(`iVlEL5ERFlEL5ER =E8 užkyQK%<}j> (p}(8c(7=21Ei(5f7՘Q(1 QJ(BVGJ(NFHiWҐqi,L\7\EKOQEABI[p'YMoyγ:/P}(֊U_WQGUϫU RʸQEIEIʤ?0RNr݅QEQP@QEQEQE{B0qE)v8s.yak8s.yakPn)((A'F=$*+3 >d3_ˎGJJU;~^i<e_֧yS喰{Zڊ%rԪBş}J*NXQGP U8.WN*KQE/Q%(xvQ^Unv_EQ=i(E{?&?;QEQE8`&{һa(;qa(aEv@4 ^N=&V<{ M_eR<_1EuhB(?)WE<K<)_Qڊ(+sp)G#4vҩQU=6VsG AQX_#񤢕H^h8K\o*Qץ*R٫(tI_0: / W QӨQEQ\(QEQEQEJ݇G!澫uCoYPh(^*nohUViSW (U4G3Oʠ?FWX%?OʢEWyER=;PWSJrX9O9s䞰{yP)(ei+a(*QwLJ3 (4Q@89QM՘MYQJpFJJ(pjxxrRV8|=<<=%hQERRT{q^OSr}S9`O_QE%(=)(M(#<ƒNG+.u,CVyP}EʒpCe1FB޾rN"|+V<.WOAwjE.ӓӏzNIE\40cJ.jQOdQEu'^V}Tpo->]JkyiAGj(+ (( (( (Nx4H0ksg~ʦ)9?eSX?(4QIE)]OZJN3>tŠ((()AO%*^no*ݿS͹~RPv+󐢊('njN΁"=FFIz/VXٖM'#'QU.TݶKEUSv( [Gq18a#<Zz[k0[YY2mr ?ĶpK ~|FQBȓWi"(ե7{*}ZsprTW_(Dl@?d᫛tV7O2B-bZ׾{0NsjKxGU!rsXG﹗ߗƢo?wedO$VzGqB"*+ޱ6߇R " 1 cR˒JtN\Vf=T'=o3;|N1QTQK2p]h5be޺qX'Iݳxz|A8aW!cVO?Lim-v.ds '"*FU8oGhc$%ׄ[p؊ٛÓ۲׶13}yJ:wE5NOV]%y-aS#NYE2Q n]2ʵ$ԕfڟes2ٓWp²\\۫q toCaCo,Djnp{ᨭ|;w-Y'n~VU'ny8f+ҐjekiWi#c1Fe[/᫸w#;I,vAkf5RGǧj+SOnﭖ68;w;*h5q2 ݤzrqR a$aEji #h'i:-.w}]|KcZŢ OyV4ed?ݦZ$1EFUbӯ>nfnַؿR[kXƢ?-Xmh?v1;s MӮ=j[xaªc5y+J6lVzUY-,!^Fg-nУZG-RZ4n/Z[EoMud4+&X"xO=bUBۭr4Vn7X仴Go'C{YL,a<VW[pX:MlrTV̞U[o)ڇPЮhd-Ldʲ $'?/Yږ&pJSS Zy !T֥i̢šq*?-fZ|mȷwd?1U)~֒2='**sʴu QN=i iC/s bӸtE%Q^QEQ@QERTT PsQ*BQ@Q^֔xskWu>1]==QEQ\QEQEQEQEQEQEQEzw?w򤢽e_x+s*';^G^QAEM;wTLɻ8#cWU1Pޙ=C]O'CXoa2Lvs{Uu]뮟IթM֍w{~Gi+x!HŘUO iYkLq:]p=H\\aiDyL0k7]#F0 I~w}GN?Z>y?s54I+fbHhqV.7׻; ^'QY?MэT$v5׷iwiMy2-W3{?ƢifpÀđ]wc"J:FHW?k7lZrCMd,H}uULLW];XK>A[D;wC}NfC&BE$W IE;]SBlLii$)~>oT> jpL\0/`]KP:H_C|o[Gv#s'NbnЕS(9e7MtF6Т1;Iy5̥(TUxd I.eBLz9"=0d&R>j崆Sdotfd(S#LTp$-62 :8O,M{vјbm*d8#ҢY!}ѷY7ӮTΩ}mQ-Qaڋ/8ڠ~'}~jGwf^#Nҍ_N7_zRiW-B6kZj$p!y*Mrq[jvw.Y$c{[h!l1gLf6"r_Xo᦭һ:&:sF]4Ք'^5]M>GgKmⵅEbϷk+ÚtkȷmfB>/@t?M[ˤvu]t>"[Sqy2ځ{vJu1*rxMq_!h~'7]v@T} 7?PeCNqҸspfYTa\?qfVkC&C+l=)c_i"18Z;rqsq2\LeYN@g'NfSS! Y94g}tIbqu:'n:]ɝ'ge[ Ļ/1k&}tIbqtQEqQE($QBvvQK򞸥ٓx^;\/?0.oyK|RQAu3^8SՇ_j)vTW{#fuvA9(8((( endstream endobj 86 0 obj 11992 endobj 22 0 obj << /BitsPerComponent 8 /Height 244 /Width 247 /Length 87 0 R /Filter /FlateDecode /Type /XObject /ColorSpace /DeviceCMYK /Subtype /Image >> stream Xw|T'$F'* ("6 (`׆*rOP V"vEC<,3MGΙc%j mhm HA mt\¹Lp3 ihəƩjΣɉќ*M M4Xzq^k-_BG&,rԶ %uߧ&=>jI{Ivhpq;:8^&c5Mo9sտ(lmA_~Vm'N7ν;h/''[WmIjWaiHDy;h(& qnLYaP˾7ihtt⬕{#g$Dh΍񜁜<(*=U|K{HvhX b]Y٩m-gc:αIwU69sipNB msQWsZ'-¹ӗby6a6rJ~*574|gբ.׏tN&L9١} )rjnÏC2p ]}Pۯ֦rW/>+ܫy9}'i8qs}mzsf1}WܝA?C&H!J/<圉Bzr~="~ܔ6 :_vz·Ct4%c"wSуJ1A3LԫlZl]#/휣nHl^;~~5ki0Νݴ$jи;Ԛ՜a#~3vm ƿ&O.|F4xW|5Avfqϧj\Й `,ڬ1&Ƒ ] iC߷x]K8OgE,[k8=t;/'1Mqk4FOΗVFfOg:`8H&m7!s8VgQo_󇃜:{mvS6ln>)>hSIA7ggc_s /Tw{vu*gNYGLjo9}#m "7t@RC¿wAW$_ FJyPOTo?y/g` c}<9Kg:,t;HyO{,{T_+Zk_霻6i.3&αtIzf=<@k8ݛ`S};fN?ĦK]r1r^$t*_t/I.ы Vp~Oo{֝}YMmAmwE^\K1rUA?5yt1T{ճ]ؿpnoY ;}PsnsDlAkm{3Z3sb=$6/3П3^'~W7\iIc9 lh"?粜w.5HNqهv1AɃEWDQ>h¾CYlOOygEN Pcu>odo?ow}QޔZO"?Z'1Hv=қ*'.۸9 8W8 tdCEKi}](qkEͼrؗMy7v6=!j2}OuiBgK>9e8;sR`hMx&c{ίrn?}v#')޾7)>tg.kz!8ș'=TBUin+B,1_7u[նҿY)҅#mԹEugO񷅜8Wۼs8O+^[{y5]6Vwɉ3=>WU?8( JV:#WҶ|%lצ(qTŘ! w4s6{Z~sooϜ͹\*bm8wpi58i.)沛qa;?39_KvH?6W&(ViFy'1X1B Ù/x?zOa#[J=8Ņ@~_Nz&m Nw4C߮~*?>W-OJbWrw%y1F/tkW9Dmc ]۷T1mV04ș)ri:[~)n(tmUȓ9-s~c!v:rKs9ւu[a￉~eo8$]YgQ Dh&}"k^1A쐶-ɏ,r9q}c6kܠl/v' m7^dtn~گ[휯D|'" mrV {W+މ D\V]BElO _{A YM '},cW;6J]"fN%mow 955̰M<-Ct9?Q׋^0.BQ3m76h5'l؁8 %'m78UL&ly%}C׏q&4ѽ"~#%|'7AG&6i Hۤm mA&".&mm6A&i{'gAg{}rН {,m!mi ƃ\Ad Mi  6ADTT+--fZʊYLLe[SFFt= ?5a' f[1#V[+ \*EFVY3< y'jk.&]pA0S jˣXB[n5m c:ٷy۰"[gq>~,3&{7QPPbk͛#3ϴ`_}zm׫W~׮5k"ٿݖϿncuv cV4޽wlaIۘEцlY4ҥp_{-Qz[=LoV*پ{{mxҌ]qEEE%ǀ{,Zi˳ Ѽ3_s._ı ^[ =LnUxs+/4(Ah;:}A;QSRS+meK8mcfe~;IoDݻUʱzs#N,q]`ҤV| |.7ݳg0ݻ؏?6cS9s6j߷o8Ӧx@=?YՑRk:5R0.1ՃL \_?֓i['fc5״ut ̚蚶g:6mV{hafi;;LׯG޹s!S X bkG ojrGJJG^LRDZHurKoq9747 2mϝ\[`ݺ޽;O?=niK3o><%??aU/0f q˴#uwvc$\br+V}NM~LUܒm|ҳ!II 总r?yA;9w^6l4;޻mǑbtv-;'2Y3{1==QidG8*ӼQj[Mx 9 X(Fz( {+;}ۿ_tCЄL~Um]m#jNx?P[A~"}tq'e`mhc:h⢑#um-G;NIHΉsMmw`iwz0YNxhW}ݭ5g<״[&= ַOѣ4}|Yh2s8TnݺYS _$Z?_uۢ>Fiҽ@ΉÜmY~ zq}='ӅmWVI?77Q.bگTĕ7.3( ߳϶Wc߹3hǸ}x;m2G:?Qږl(%=/m!lj-j 9Rȴ;u8PWh;dHR:{O ,m#Ɛ[ԫO 4ݺmPMI3⯶QRi ~!uZh>T? m:K{p7e)z_Cvxx}\0N. UM|mHJ+VDFF *{#[><3ϴ EhkwX:6AUUj㨭赟?_X:je4,m~:￿^#Qrv=th;=4(ߑ׷gjVn闶ի˓O#{&7U/<5*ۻ^0vffقN椓KmY^!mԿϘt͛#4 eҎWsgg,Æ`i6Z9͓#Fu3OKvx۶-wm|=ZZ^{61uj R׮{󚛿FUf s={tPw# |kGzZz$G: =,Xچݒon׃=ف^H=Gj ^8ZS v]֑jr6b}HyC`Ȑv80vZ;_.Y| F:[6r{5y sN/y_۰Nc2/f菶QÖivJuZվkL-_îe$@(祗Rm폿چM;v$6ek{h;ӥ}5m_{-KGΒUغ5< ...ֵ8̣Dh7yrK*}m6?b4 | m,9sYn/xOd _:%|>Uw嫯tmhK6/omm$WZZl,]nxv,z\6?MgmeiǷmi|i묬25{P׷vKۘ3Y6˫v[v c=zm˂Z{^^^슶<-[G%莁XvY>Hԝm#_8aB:}+sZ {cHiĮ}3PC}`LVcvNniH`qeey}9zZ`eEgsoo;m_<,[_7wM-[Vx,(~[) {9Y'$+: ކ5k"um~q\ o;3ߜ@۾;=s#BZ9/*Vv (qG|Ig9'~۾vƝ>=Yն]\mO `/eE^qm/;g6>򿰙NmmO-ԄϮ(Dۨ'k"^?l7u_K|:|)lom^L#\7ֶoSǏϰR>ڷ/vvըtj.Dۨ֌X-mٛ7і,/J{Ľ.4a=m/Yիw:y4M{}zc n{b7p_=|G=G/&n ]۸r^ v ]ANqosYff&;)ywcEERŞi5-wPEqWm?#(5mQ㕵1kV" o]VTSązcJ$$xXS?S\Am ꓦi 6Am HAP 6AO*lYɭXMM?gUUE,+EFViOLxwB6,<\>L7|<+j֬Rmtt'$8xSMXX~u6mۖ3h֭d[Z˾}m{,Vkڲ={hQ4kѢB:M"̚hi}}t|[^^\ͥf;#9k0ݛ+Mݱ#m֯ؠA3'-z5ҳ-[½Nu׵ݏe}qQ5VTiseY.cԨlwoKMkiػIZPa8s6lmc5o i:/ʢBEM_۸'kF#æ?da~!47f,]L۸1ж >m[ٛݻ}r}# HM`uszD[0IyX6 o`:s6Ҷj۷>yy޸U=rڕZ^L+VDV*LqZZ>yyW_|Gvw^m#YLWz@2mZCOۨM8=m?'ͯf~g>[Q e,mcj?sfmmq>cFm ɮ'tOдjU:f=o&0ٳ5iR1F0ݦM9۸1kju=ҶO͛o&kXWvW˖S6F0hƺ䒺iv[qbkM*uk 5rmoOme@mbluݻ>v`$ƮJ6{vvvZ^kS1 ߿=M޽;Jk7GjwjtR{]ĐvllnjvYxƝ޽SnP68M{dE c1*jRa*?8ԡa_}5ŲJ Azom.] IC6UUE{bbo]mcd?矟cxk#ؐ!yk2߸1ƶl gjW߆X4ZmW۸fimp&Y>UVjkW))1oે_^g3f@))fEV׻v `deCҶUt俶jeewܪ%ѤmiOIM ĸ~VׇeKkzsw'("eEAwb[F>|;v7?ngO}Pwum[Nv%SA-t<)]* yYmku>N&}޸A mA6Ad Mi  MDvx57oVѿ[whY Kȑه9v,'L?;{ƾyfnc11kFO>gӧ'Ncii㖶:S:yY||fH2]X2͜]qu`ִcGa7|"ΰ7sҥ͝Mm쮻|{w=޽aoGK۷;w6-啲Xս{k{E6b*.rEۯ"g_Hvׄ;oeMжQ_/j p3{+](˸:}c[3`/}-YDD#m۝lXn4_hۭ YJG ,+̱9ѶmYE]Em?>Ñ 3:+m oѢ±]ZnK۽{wnݺHo>ݺu9[yxĠk7ɓ[jᆡW}2eJ*{$7Mݾ}7d ƘEeez&Nl]fcUXssݓ>H0}<]sst:iR+iK}?v[f'ѶMk51e~s2m_qEtMǶljufL/_M1,1Ìiɖ]TT"9z*`^[*EE߹mƾOK75erCTT))fUȵ߈l86תѿLީj斶/,K3ϴ`e 9@k\sMN2j͚UJU<E] k~x˶ۮ{,дGF\~-F׆Wj|4v6|džsc͚H]}XGHm[tOFC6,rDj]22]6 /juWn@makZd}iۿ{[FKƵԗa 9lvxdoΰ_mo$ddW琐{|a_9v5=9('is4"W'/Es'vRuk8ݳ]v߾4}TWSߣxϑ{܃0pS6??V=ti ʯf\o6"6uk8Fچm¹lٛa{jv95u$V\\b)7m''{Q\:v%ڂheN ھ 5{z-LVަMKʹ sĖ-ᚽ(//6?v l"]ەEܘԴL8O+~jKIۚh~H9m¥sS^I\;iezږpڕ^wȮAzz7WT=~j5CKvȧ\XXpmxbkjn -Y!m'rbq8om+C;-f)ÿ;6@o˗p/[7>C;5Ub>jtȑ٤m55bQL&iߪUN:q'Ǜd換i>:nS8rBoƍĉI۪ɏ=F.Cɭo&dc̘LQ9|~iuV;ϟS&e~_m+uzx5竿z2 yG7P}{TRRPm xHsϵGӉ=[CIn(a~3mU׬> Nni[y]zcY0ڎ5Mu])f%2sGdmC6)/..%ǝ⋩~k[ch;?jxΜC~zoPm2%5ҥеF -)Nj/[6 mMgH_y햺}N3XV?oU۰z-i U{Uu\BJC}vqpyD_kN{gsJKCnggyV4(_RyiSodWӧU 0F0=|xNPºu74׍hXw"/*v9(jz-mݺ\F|ӱc71#>#'| FΒFomnK3ûڣfWS#"`?皚xV[lΗ]&Cc3-+u7Hso-d{]ȇţ2]n鍱zv/o=\Q'ㅅ%~i7.S/ON0]TT"ƓmG۸ ֶJ'> F^^6V;KDk@:eweypG{llڶpzcTWdvU׏O1}m[&={h%|>;ƽBɹkuj[G?fR+VzL7h^}uoS6CN9%wo'|?w~NĈϑCm;vP>;چ'Ν vBǶ#1"EEYv~yguԙ7UCC}.NsG9!'kyr6>$ߞYȕnK7>l=Jmu3mtSe>?lcs͕)ng;b/7pvvVIO۾8D 2? wdMXoc olA93Jm˴Ҿ}ijXՏQ79&~:Wl7;@;ÇzsMjN>9߯};'T9>o';s7;\յ} i HA4A&Mi  MDh 6ƫ "$> Mm6AIA&AiIMd mA&Ҷ1ACNm8 mi ƃ6Am HAPMi HA \Am \uu endstream endobj 87 0 obj 12836 endobj 23 0 obj << /BitsPerComponent 8 /Height 165 /Width 466 /Length 88 0 R /Filter /DCTDecode /Type /XObject /ColorSpace /DeviceCMYK /Subtype /Image >> stream JFIFAdobeeC 4"@.0&4KBONJBIHS^xeSXqZHIhiq{QdxC=""=VIV"" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz?㨢:(((((((ERMN=(IU4|S au@)RKG1Xm\oQEQE0((((((((((((((((((((((((((((((((((((((((((((((((((((((()@]O+Ǽ[ )QEj~FQR(1IN)8 qרQE)ԛjpjz|aERQF(<*J\+ (((((((((((((((((((((((((((((((((((((((((((((((((((K32I:_-?By*撈R3)fcUFI4kJwB_gGwg'FhܿM^?fWZ.8CݜRZk!Xc^-+ªh\vkO?/ՅR{:?}Q7E[:"{*ۧ\u@?&+dE%{qPKX˝-wyj^ /K?ʔU)Ymme?m̰-cMs:+},l4hbϗ>e>POQ)u>.~?T%C0y2w\|{T_kU`U/B?![0Y4q(8gz4WQ\'(86ӻtʵkJwB-] idP2g6: Ѕt}s 1PWiz#4c!XMXU \Bj©-?5]-}:櫃GJ,ԵV V x!Uh-&6ff${>g>QOTQ:P'{<-Zr_$¢\?#2({8 ~PEY坳?"RJ>.p0-bvէfH(vS&UsX''j+D>U _B88S}OX c,zE(mTϓgk_B$Rh\vk-˜m cg)>ec#d҇Oi}y{V?m?&p?zD߇;b%aqY7 θO.h7QS(jև=L\_+ኔU"?P۾c(Hq* ta3\+VC5ٖFөt2)NRW#EOԮff>RREhqQY_fAugmt`Yyq1szu4Eke.\y?\p9a9tWc\zW٬^,⌣EGcL[t AayYW~.?Oo~O~JtU_gn4vk6X$]Z[!V}.`M$rS,ÿ&XI}roֲ*m4W\DMn+|QLF]N̥E>hd :4(-幔El{/ⴡL3?,ִNZS9TH#2;{AV |\_y>5EtYE˴F+V,O_Ҥv} O&X>n~:*#Ȱ╋hOqn2'Mtvin;S]%;HEZП K˶k[Y}\.e)>Yܓ?MJlTU/cdS)Vbs:|IX>b~G~fq5,PNdѓ|~>e>POS6q/*ϑ'֜pRnK X97neBkTR[ܬ-anܩ|)=ڹ(C:(((((((((((DguDRjMt6b Ᶎ֢p|tRThSotGO5¢3)fcUG$ۉR6`\̿{g6-w:%O_VK#u*v=Ar J#ۖ3=?)(TħC*Ew;UGsMOO!$._l]QT4Xuxq--v+/uFwdiZGmz|}afBWz~rUޟ4 Zdb5m_ MvO*M?CVYcWO?^^#4|c!XMXU \Bj©?gi]Bipΰt ZdЅqUz&tjSkJwBi_B+B?QV o?W5o?]Kڿ%^_[cNJ2k8GTE{}*$}Ly<8zg{kQi!ɷӧWB#v]hC% (^G;UGz<+o^ҿtC?녶 jaRq~4۽oRsȾM--v+Smn_=iܻ3|WWXr*iy#m?#IӡMg?M4,`[ߥ;wgrŘI9&3ViSzull~G]3Wȱ6|5KBRݭg<6"KqyXiC;+ iӡQߜ2F}rz>s2EО7/Vcqo$+N+YT']Uiy*rR9zkvc2-ўO5ZŽk;F7)kZ/C5Knİ1mXȭ*Ռb`~vfz nS57چ,僑b?["*}SNf( .&S,SZn`&3sm_ޫ¹]jy;ku&-נ®Jpv0ڿc:<7WK$;Q3WJ:uaI c&eӬmFXL%'nQFh'L$r/ zf$Td!xW ed%YNASȮFAmmκhf^HYUQ5ǥ$Q2noukC$KeǭrȞUJ]ny5vǸ#fyyEK[PZGFOҿhxe{{+OY+o TiRoʑӎG?iPu\IWȼ"tI[FxsJD}1P[@1sdT ?뼟 UO{+r0$^q?gWORRKgIN3khHl`Gs轾R)HƹcZT(8QT,K>cO__|Vα\t3Gk5hFU#jPJqdN@cŠl<-i +]O&9U%PSx / 1,F51!@qwTu ,/쑝?/]ۨ?PֶL y;3MMo}wlWȸ0;CJqΩ^ΖאG5vz|jl=cR3D^"k(0Swcf'Ԛدs,aNvJgҡu&coNYcuKU ^Y Ѫr>WGQ ViiuKY@r6\<!GC+ѼJ*[0,mߍW񔰽 ~UgږaqQԖĎ~ TzG#u\Q^(((((((((((}Gu5pePWܮxJܿӼ2窞E#"It9R;괯2W^^]:?Vf{X MRtt> HnURԮxJxHV[VcN{C\R<2$GC#I,*}e?ʫmu*ñ2Cqܩ"=#U%Ҡl٣?lִ< w99 sFѺV\ezDַШ(挏ztd\RLyd(b%FvUPOv/}ɔW쉿sOROߧɜOޅ#7?`8 #>=?O2@UlKMOxNjn%Ԫv "?zxiՔVԕG(K?/Յ]έEܬ;FUmUrRFiPΰt ZdЅuWviGXNQr_,BU9RNyؘ:s o9+B?QV ݟC;i */<ҿ+g]Ѕtڷ~ER~EROtW$K+5z_[cO70k~=*kOu5&={ *n/𑫬Kҭyy8 #>WlBӮfF;OX6N˹v Pi?-szOоfQW5$*1S,k]/xY~i~[CJ )doZߗ17֌1*xJ=+* K;c8W/vgbIcԚMޙWKѶ8r|:Wwdm2?i' &K##I+ck3۸­A+eϟs,'E^1OR^i'~ֵ?s1ێH=\iGG.X$u/BmRS@F݇]4T,3/ʹs\}G0El=\SԳr[ȫ`"JLJJcz13.k'~ű] Ȋ_\vZ]V frFz95Ekc=[?uB'}NcD`?G"0ܟkZYk\v֥(b1c5^6#,(B2$sc\zW5CLo+l-tWQ/]_4y'ek++#a]6"m?f @.t+ *HHQUi+_"?Vk>[u{#| ?~sxGRp{lνAOֳBG"YG,YrJ˵&: yq[h3ѯs ?뼟 WCˈͬëzOֱaaD f`;z~UJ[Kr v7kn2ۮTPvVaRH h*Lo7uc򟡭)m~5o~{O Gi*람<:#\CBWoo9FF(U"m/63-Տ5~O_x?1sJTGB)ַlZxHz?mɤݐ*%S\W,5\n%+ȞUJjỷ9愅cWv ڿ6s@0N_)L?RX'F Ț?UX!"6y?֥MsHUeO]~/㗷.fB`:I M u3aZ+ہIj/ e2ޒ#X֖KȽ$䏢<Ė$ԚއNf?jMiO0q+cvވU#vކCG㚨݋3NI5x{M LSӧPn ˷h V%Km /5SQ *;*MdhV!Kߖ][?!~Wmt5BIEUET(l󛢊((((((((((((*{[ۛ6ʹ9ڧ?Qҵ =j"C.:I+襊GJrhޖ"-!&/n6Ӽ\jGCZx5U!IRGa](a6?"5Q]?ڸ#FX8y6"5Q[sx,q=J*,X!8LGN穌S1*)3vo_8e8"I_5kgYC+' 9(Q[+oƏJo獷XtVe{x 4Wbyek'2(=Z[i-d[F|(ή|WV9 Ym"!;OU]{RȀlvKk^[wp’),]>)_?ԿӏEk9**#xzO >-SX\JM 8oƹ+SXſ©kaR1Zˢ;=/qN;DmSkKRqTmvZʢ$#,rM6+G/#3rM6(K-z;hg瓟_zˢZt_57f)B2VaZ>!1ǝ瓟_zɢ(V_+oƱ()) ]hx 5E>YY^Fŏ(۾tdoē4(tbN"efw'8ڳVtf)F2VaZZfs[0G +6I9f[_+oƏJ/畷XWO?x 4WE9q")狭8N%wo񪚞s@*ۆ }6(9(((((((((((-9.bV:6qsɭӥhcbg_zZRoF)I-R9.aV:6qsɭh+1C+t2BI=>u eE$ryw&psEr4kr5'7Uh3*($_^*?k?'*;+GGQꄪh1oc&_s?*GqJj[P_198t~(8Š( [ rUduRW5O:k5į`՚4Z6r'Sqj50⛏}=)МOaAn꤯^kΛmM5ƝXkFu_]ɦבnN+%'JOO??U/|9>7mK}&ԿLsGw''}_s}*k|.?QJOxd2BZÛNOXuNjpQbn9q. *1Qo 57rGi)=ss᭧m?U`SYJLEcCEpN-4rE[{yHB9hS񗵵hmD' jYI&?7<-DKgl_W~Mvm/__ J^(bq2S5ʹty6?54I$[[F ٲʤXV!iǗq^}5]x8mJu;"yB7ꗚ=y:m8ie" QoY1-`Q[jcZM'i#xdhBOjl h 9Ql Eq %vӹSNjB>.OQnx^c,2\;~$oQӬ5-CZ-Ŝ(o}WR9G-vﮟ3Ys/S<;m}s$ң>rpHn[%cr_ n4K`{)8'nOT}ÿ?&+9+{^}>~gf0,W/^ CmBh=+Ϋ4ң~6C<=IM Zk<5bdrV)X5(\q^kEImsLHWuSsQm]Si)`-E$+#u5[Du768'ihv9bl#ӷv_fMvBUiR|X:w-t|}7ta?q0T*R%TqѝYGso Z;nf&i4;BUR\kmݯ"黣ivy КOҵ2Ȱԅ\~kGT&Y3E'+OƸVpAsomјUkKKBgb!+ץtOildX'YUq?j^i婞,Ǹ9_/ƗX UwOXxцc9ҩAӶ"ycKr_F$ci9\w׭6[So6›T~T~5W-븺c䑛ڏk~FFE^ArG0[p o]6ot,cbm'+ZK {MMd nUU?~5mFdX_Wn!if '(֭k:Fȷws8+~U2bYN#\S¾Ocy</mBaE}dn!֝6!j2O'mVU"vg=?/ʹRU^= " +nwwp`2,o0O*:(( (((((((((()6k,HH$q樮x4ޏs&:&*9t]-,mS$l8sQEW1QEQEQEMc:^C;)e] %&k96ꤌ(>2ޏ飊B.z2{ K,nTwtSk)6ꤌ娭=_ʏ=_ʰ_+;GF@K'V(~KY5ocjwʶ*u$I#:Տ,$t/䵍,I%>LMw(0 (ޞqm $UK=]Wsֹ+:F^gNXԣܽjךq_ZkkTӕ{ϲkZìŎ>Ox٨MWHm֚^F}3¢S JֱS 7lŎqӁR&6=(g9Lh^L DSyoXřNI'$m\MZ%rV^kv7/+f٣*FI?ֱYJvSV8ӓci-+SҼE[;y0k]p`9AEQEsQEt+x69EtWT!N0*|Q md&83s(A Rcj:+WtPSE!ejz7$#>0I ?E|ELD=I#h(omRоߘ\SwfF^NM 컏QoDZ(AޛJg!cwfF^USqywq::?Enj7F8rHXtQJyח<ޣ#sZעԬ xp$_:(4MB=6x&/gQJMNT+ $g )pgQZhqeQE:eZns݄cG&Ǫ,8Z?+vrs+&(}WLT'}GE:5Bjt B2+ u^*Fӌc?YV~Ml}IE5*JErC\SSI㉣ M?ֳ袴4b#y7zU_M&k ʰxzfsҩ掙^iR7!OzYuII/Uo()Wg0uޅ}ϗf~]i(E.LT8|+)ᵔoP()hQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQES4T]g(>S0)QEh}EQEP0(((((((((((((((((((((((((&Z)8y QרQE)ԛjdkE/QIENT8QEQAEQEPEQEPEQEPEQEPEQEPEQEPEQEPEQEPEQEPEQEPEQEPEQEPER-"#,<9tQEQEQQEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QEQ@QE!ZZ)ZkǖS (E>3t ( endstream endobj 88 0 obj 15285 endobj 24 0 obj << /BitsPerComponent 8 /Height 185 /Width 444 /Length 89 0 R /Filter /DCTDecode /Type /XObject /ColorSpace /DeviceCMYK /Subtype /Image >> stream JFIFAdobeeC 4"@.0&4KBONJBIHS^xeSXqZHIhiq{QdxC=""=VIV"" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz?Fښsmw ?ul=+ȯ'EsZYvtQS_wgF Mc9q:zp9mkh:+3>gу^Ey1^\op3) r? ENؼ& IToo3ʰhUCg}9UbQEx_oQF(hId`}OAbp3 (C#C*KMFdYTFi+$Կ'Ь/0k`'9?$B3RWmmzma!_3ʰhUb[kg\xغUtnx`]'* kg\Q\_vQEm^c?lcEz %<[~| 09mŒ5jלmmzma'_3̰hUmMOb̪3 O'綳•74oQ-~/*Vx{kW*0=-+;j&(+`(((Rduƽ/kJT}DвMk'g!CB1^kE:H)7]SkMX)FJ:t%Y}EPEWq I-1tZ>%9: p˪\,>.0/+qI- 1r?B+Z/\bkRO̫" pUEWiQEP׭ѣ'T?<JkdH٤eX(f'nY?]|s õ6U(ԥfg:-qMy;SD#"Ff (מé6 2+T6Z#2Weՙr咳3'Gz_0na$n&|sj2ے@+&(#(/a<eW>ZR\X-6k“$eW>WW5j1 m߹qGu_CЋtUrCwP:y4Ph6qG:~QEP(i$,o>݅QJ)hpQ]ltAERP(Welle";QKRZFd5Ϊ?Q,n2gЏc<N7%MyƝ7'P2AyGj ?AnLtn>թL*BG Esrs;X^s0 9 Gu/S(B( [~([~+{,28QQ+i{<,_}Oi{<,_}M[y~_S]s e=dp*袊+=0( _dF=]ok,dF^nijcNI5gmRgumSW:dFx?km%V(5,ŘI9$+換(;obTqYx2>.JF?-ve&ݩـqB<3mn%c>am?]]W-cSz(s(Ge܅U$QE#;Oa\W'wA1EIq+O<7 #89ᱵ}VϜެ(p,A0ұKYar5ዏ#XIeS?P+&9SF4`*dykJK_ ԕULg?@z}oqee+?_?_:=gaz_e>ϵ[V%v?G%v?GпpΎ/kƏK_OX dċk2/#[50dc}M7;¾jj |lJe:5ٵRLH뤼hQ{)X%Ĺ3iſ°(D? ?~g+?Wf_دvſ³ ͬ[7ygW—A=VVBPQLv S+G^rUhҩL}Zof uƯ/T6V6Jn(v&Ot^}iQ\ߊ/%b-R;tnx+>][Q5mZgF.ѻ=ГӢZGg%w?JΗZ%m}:#ⴼ[z^ %%bTb3k깛כy[nLżLjw1%_>yӡWVrM~]?.0FVIXUf_1sgFJ¶7Es21%\㿡ϧXzs$zʳ4 JTI!U92]]q4D+Rj奿SsԅJ1 t|Io(G].VWXbLF4C?+iwdmG'f?_;  )F!JQj֓s=N|Tqx?5}W]EbOǧH-.bIE鍬vj/J?owka唬Ϧx4_,fvTV LjbdwP$"+ckTϴAEsϼ ]8_B::*+}ƏKwj-]p:HsVڕ2Rqk,TԪI3)קzn(eݽ"?U?ҹ5vTX#Ttp[n;_z W1T9kBÅQEQ[=hû+0eU>)i -6#Qtʙ\(JZ(\>Ssoձ$QE!hv(_%!T1 ŜNzWKyˮmsjǵ"#~U8Nr.xy#R=dK>Qf*Oa,cؑ?U#~UQ[QAy?ٸϐ#9*+>~`C?+N~ £XnngR)<yB_dsWE}GqtM4.heҭ9F ]Wi>G%v7;58_Eh_g>G%?;5cS:CF:ʟN*yGo`2 z;q"wx Ҕo+3Э)F,xњ1gTuZk`2ʢ\ۏT`Q[x?3'y=Wn+};>]!oVw~6WkH<+ͽK4Wg>K5h\%_q/ }\~K5Y!>9 =R}k/^cԡ(#tDbͿֲP)Fت(Sgn~͢\@ij%_q/GuȵHa69=~5hɳ&u;daEP(>Y&Ngu ((4UT,kC~EQEVgQEhhXof>W{^dNH\ZC8[[Tguo R>6l;Y_^^VNW.lF<ձҥeôVtWԁZE2y+ye7,64R"! T1銨YUQ5"Z[h(3ۮH2&>BGW_|{FHGT2T6>LTGXRj}+_1iF,19+/W bMw"u[=NWo3+ϖMBÒK<3\S[indyCėwr#Ѳ+^:.YM5Y /Q[>Sgc.|`}x-xZfmJ }Q=5ZME+U{{.R(Dѫ[-y  TZncB>dv5kGrmhcA;ǘvGLMaW1Nn;ۿ;N3mX&$+ZY99,1;TRnB4`}2\g&Xn$A5G tNl $_ijN[p oJu CG(mt#oU &T?L@ܒppTW[Or-V?nizDlWgt컂t ;~/$wdF^_ҸZ^|>kGb_mmt ;WqHіDe%EWyEQKI@;^RtU(ZJZCZVzir[ (KH)q]yvIF44}$${_o((e~_z9_p)))_?1mg.dfj9vq(K"mi ELW [XNvo?wզGKݝGCiՖT^W-l>Tj\mӭZ;Q?tQEQEV<RAG\oˏ7Tv\{f}^z_#*<,A\.|:u$$zC\GnchҽaT]ΐ[d*Uxnbѯ/p߹*9?7G'(>ՐU+nhS+o&ssZ%֣mr+Sw\J/cFTEI/92R6X)Rսap +o 9MKJckJ+qR=xm*eJn<ԚETzPvFmM.Y#ǓV袊(+S:CF:ʟN*Ϻ qFԟz;61-.f}%uǑcΩIk2Oc7EQ^aQEԽعU5?/W (+ (( (P(kOPW꿦QEQEbxEQ]'t0N_Ҹإ|$u-ʽ,ī?@vf)ל\5tKT\Կ;U}?v4VVéL)}ۇ~Ú OA_aJ*ǚ>ٝ(89}_U~(E/x>ղW5k9^{!cdsѺV\^jl,TIpVc6o KTq߆&gcac >;,RC!X7^˴qnޫI-?.TTC2Giq2B)?[5$ivݝq5+ >-2w{HȨ>E^b~ 7TX3=hb#攟'u0dH?G?]?`/ >fq]7LIS*2/w ZG.6O_4KZk,[چ77æEuWSrX+[iVZaS͝F$$nQ<*ǚ~X'$j4ߚ -u㴹)u>+:tHo4FUu%] c˟mZm-qȟuQڤk㌽"8 tܣldJ506oF\MxVP%9<]m1"/#sN[^F+ƪ^*:g]8Ô|IuX˼ O'Շʧڹ5[+Dv\WS[\ھdDysu\ח omG?*zUPEnl}T# oNuKTuO!GDKp*֑Λe֥*x!!ٟ_C }_8dWS"8R4nPGqRJ +oW@W:ƥ8bE'lOR vMR+F b+e(Xm*pA^C-z5xv޹OTQ5SR*Gb /M:̯،_:݊Vʕ_ÜzJ1VRN=t4jXckٵ)=sYQE|&mQE*Y#,1To@)hj5iF9SX()i)krNTZQ"ER)hmk{PN:QICKI_;q2ug^2o}(Q릞hy`&|3o}"A )2YijcG^y_'W`b2xCy"3\ܐ~UXxypƹbk3¶g!%Js@|c $[|pe~'UCplcR[٭:%sݿZKh)768{W µ2#֕)lXşdLZ-m,$Uw1۷5u~+mBm660ɹ#` ]:Q]DϜz% k.&GS=MWHݨw;?}-cyَ_E.T[޵xN`)%N@SȮ@M_EXJ6*ON#$.r72u\jG_M*8._?tn,R>]XxKO.2]=Q[j Bawa:\InB7:}}3SvzDQ>_1Wt, " |°b]Eab`Ivs$wm*X4j ֬⻖?5h?ҩ75BINayxhI޹#-rHd sʰ_%۶"#́[La%-=Y?j#OKߴ`"B~^Iz3 "U~/sQVNGƽ-\T{6qto5l!y$wkĺnY Ƹ? hE.a0jvJѷ c'kʑ}]n\n?˃4H+96>]9_6S2QW:+M$..y2&e"V&ϽqIkSdfr3gQW?dj]hJl*Z̋QMw6'?PzKK_0'!k6-lpKkg!TTʯtϖG=k*-Ny>'?Pzy"xd1FYpE6k/[~#UmG5&+ &]L9a*7bI 9chz.)_zޱ][d>nH`Z(4 +7K[e:}f/QEQX QEQEQE <1֚D$NTI#'+ywے2=[)}y$W *RWwR +(֖$NTKW]i^{y96WW:]c&VR}@9#qZFSN.#[~Iii$#࣮J6 0YR\;?zO/ϚTM6c'^}{uHǹw֒XdrnEɍRQܮiBSk5)bg(gbw׊tt4|1ǹ5gU 7K+pXk3_t6]Qv+9h+.uY.bi݉؟aKR,ǫm:cuPt7+O>Zдf[ZmɆ-éȿZT DĦr#_5N߼ƑxĴ6J3 ~ujZ39/ʃE@Q{W{%t@ L.`xGO[ֺs vU׫aȩ/ !Td#*iVAAW2GGW51ns O˯]!8R@ϵqZZrRh8TX3iV3zק*\pc8>^k&{1OlƖSj;Ӗ gh+UK{i&kk4rQW?)-A"He@2mOnteAabxgWWylIǮ~vYa>6Kf=?_qʾQυ_TUoKM#<ZcOW?cOWUPt<}U+a62&7(O*:LN>쨯?Zȯ8Ӫ-RL Զrbr⢭Ӹ"O ZƢZ }#$)9r[j8QIZLRvVj b>WqP) tmy.F%0HPƹVwTE,Tw5ߧOv!rNX~Yj¦*ea~aR)K]_E<xՈPƹTFwTE,vcGm;+:~K_Du/wBInI!3μMGP "Q4訇 ?(WQUew}N?%HUTz: BJK؉%I!3μڻKTID"$g 5Wi6I:ﴛj+a*q?Z=ʛ%zVi"[7)--^k^F<'} *dOָy_fon5reLU~yu^noW Z| ޟTHmb95 m潖[XpʡSw3$8tgnϭ^*XA{UN⦠N,)ՇwDsCcR{e sWK1N 5[%&Xq⠫6u )8Uj - 6zS`㊓Rvr)^Yi6Ȥr˟J^k- dPB.? j~hR?_隗=Gku3zzE ?m}&+HLgo_- =65ok3k^9׆TooO<6'"Aݎ+MQK|ۮvպ*ya=<˖ZtMH[B[o0aWV6FuҼS 9>z.`q,qF2;}OQ-psnyڸlg[MM}BH-Qc\.+ggT>;A%}RjW Fo*]QEVQEQEQEoH.m6B Oe<JoQ4{Y^LW#I*s=VbBV'jUm2Zuh5TSZQUt^1TQE(SIRIo +JE,.6d>)w⺋"KY?O\-hXkwvi;OGoΌJƹƓ:uו0|C gVTkZچg{[޲*KnVEw}2+r%8#T֮XX\C m)C߭hQTc48[ͷARcJϏ]d8[q>f@@ |jl-\}u~7?_RARW4wN_ӭ .% ]Պz?EQ^qaEWw8=&^31oZSJcr鴟cx:e؟<ykCQqޟ+1?\Wa'; b.evs5*B[śIkR~{w?/'洵G1!<! MKFʭ JՕ兜~vxkSqaˣm :eR:#lb+t7,/pT*{ZQtM<ܑFi[hIhۑZQEQExu;Weˁ!wL`uyxLF!1p9[ﳷnP؏>܈t˺w jO"\bƝEK3{QKXgX⍝EU4ږ pV bG+ʷ,T}/i8cgsU$*h.mİFsWQ?de fr>=ϩ2̖OʦFd陎VF$Ρiv[w.ۈlיXwy{Ο&KVunB܌r#>*x2Zک?*v94u)R;۶f;UVV$Ρ{uXF.ۈlU[,Y{"WgvCc{kwÃG# Z4YORV<7×%vwd>ɮzgr8>zP!9VQ+I1ǐ?I^ypuo+m?ڔO:vd֌1$/$WR٦(eOi1{J2e!쎒+v'qӵF^0DĒ7c\/]bjņyZQX o=´)qg%ȍ?z+u}JRicf*U׵ueiՃ5[ogC('eEeoIr \Y#CO^ztkSuK{fV6l^O=z 쪦jf(QڼeO5NQYR2 C X#qђ5S爔}E(-zhg7~x''y˳!f%O&E$BXdPCagtdTƨsOk?2e;HGe><9 S3=Uy{kry@+ |By?X\>>CsinfMLwʏS{Zdvpf~G?mo+7THF2=Mh;b*eQmQEQE#((()a5aQ}p+ii.(`O~5 ?'W hcVqQ3<ƶ,\ZMogSnM6drPl'?AH~!ҿ߶ ?!ҿ߶ ᨣo󿶱M#~o&I4?(!ѣy#VSr\>sퟘ޳ў+$gy~|fp7Jֱk9t%C>#ѝ9.7FQܩ5 rIv{ҩ+%ܲMf()<9jB19خ0?5k[E4O$ks-m+G338?ֹn9jsIFD|jGipJ[n3'(98s;ymV+Y8QT%FH?ָcz;MgFg4wQhSOG]ًȌmk罵_ye4UY煗Eӣobm}3ꖱHOIB?{c]OJe|FDܛԣ#ϧ"5NA5Vk˩,3Huۇ)a*i9EYSi=aM_x-ƛGqosZ1kWƺZT(sȯ? }*qU'PO*@y :=.%CXlqVm,흣7y*n-PRu2&>#T/u9UƔJ.uZxxʎD0)քjGfzn}%d|QרG6[%ĈpsdU=lR#_No'j=_HI.Putjk۬1E(Kvks]k&h-tmU_jD!`%^쯷ۍkJ FBqj[3V[e(fY؂X};~54YS|mU_lnKs 쯷9vnh6 ͩ!+ssEhCm>o&!ܸ^yxجM\+8ۮXN"]F]i> ! `w\ &?G7SjѮϗq꼏^s]$:WG$:W\5X?rmb??s3H~M#~o& +_zZgrƘ_'_²'E֞}2(o>yٜ&+j(4 Z+gUq.]mWfEQHMWN7CN,Ξ OdQEti1E ֨7Vb$d_|%oS9?/&:cUT[/sçM攕\C/?Jc:F)RGSY][I&Dmb#$s"*wTahwTakw8Fo_G#ZO?y:gə|2.N~{]]pZh.Z?kr֥w+oˉ˹kR#ZO]MD`e\}Znvyk?kJ~(J~+G3H~M#~o& +J~)klQw!U|¸JͷDJ!ϷOԊֆoR4c3Z"HQM#~o&4H,U|¼+mj"T}~Sеig]1cN}i?w4Wspݷ;^Kn.hkVU5Q\ w]P%+y^!ҿ߶ V<?:Wg"RBc9~Wv]Wb`_yۗUX?"0\ڒ# \kVJHULg> (c($k$MQӨ6HX7\R=AQ^k^&wKggT?ymKq\\*WC¢)Š(ࡅ삊(JZ.2UĝŠ(4;<,L#RU_Q]w g*A=UҭɦWiHy?5jKЄ;#KЄTe^`IbI9'Mw>/tc3u?/\5QExQE2\\9a濕rg퓌o8bl>#Ws9 <mnn_j{rUסv%qMs (F(#qڈ)՛+`i泭QR)TTo I"rI$Msm|0V=<(#A4r _4)RcY5t)JOѲA2IbI#9GP}AWo {x፣)\NI .9U>6WozR$$e>ӫmoe#P*auQ\_$(Q??L?w4W VOZ>2ͽ3G:kJ[kyF6v5_?pYԧ< ~W:՝Jr{|\|c>##A?r5}^ZQfQEW}/Z(us8gb+`v^qZvz흲[c;r<שWRYYKQ~` R+ӬVP\ 25lĎ5emˏ;r<Z/]GKz⽟L?? +S VҰ|_oiΫ }O$*+vn0pϊaQ>B5ʟ4u]ylSE<= VnA}yjyF7 %eҊJZ/cVJ6K 9TN+;UQKHhfp].N[>u#;QE-%ϗha B(:]ڵ+hvYZy-n#񜩣2p˾1PVQ­k-ەg#U*[[-.cHTפQ\_$(Q?wjakGEpj~ߺ?*auQ\_$(Q?ژ0?y\7%Z?J?XOAn1q؏ιK˗wv*[uJsY]zS:5ʡT*(^ceu%w##+WO]KzIuC|W=KGU~Si\nj9S#/֩Kz⳯&θe-(0j=ǎ*:rߙ+{mmT/T?*au}>q2mUz({ؾbh}j((b9-k6 ((4R#,޴jbE|QEQYXQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQE Z(qG WB[~/VQE+ה!VWWŠ(RR֔cgM?7 (JZCEx7PF/lQEQErQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEU5y$uiF&%h(Z)(@$( +c7<]FhQEVwXvn8CQE+jgƦpŠ((<((((((((((((((((((((((( endstream endobj 89 0 obj 21232 endobj 25 0 obj << /N 1 /Domain [ 0 1 ] /FunctionType 2 /C1 [ 0 0 0 0 ] /C0 [ 0 0 0 0.800003 ] >> endobj 26 0 obj << /Domain [ 0 1 ] /FunctionType 3 /Encode [ 0 0.5 0.5 1 ] /Bounds [ 0.5 ] /Functions [ 25 0 R 25 0 R ] >> endobj 27 0 obj << /ColorSpace /DeviceCMYK /Function 26 0 R /Coords [ -128 0 128 0 ] /ShadingType 2 >> endobj 28 0 obj << /N 1 /Domain [ 0 1 ] /FunctionType 2 /C1 [ 0 0 0 0 ] /C0 [ 0 0.300003 1 0 ] >> endobj 29 0 obj << /Domain [ 0 1 ] /FunctionType 3 /Encode [ 0 0.5 0.5 1 ] /Bounds [ 0.5 ] /Functions [ 28 0 R 28 0 R ] >> endobj 30 0 obj << /ColorSpace /DeviceCMYK /Function 29 0 R /Coords [ -128 0 128 0 ] /ShadingType 2 >> endobj 31 0 obj << /BitsPerComponent 8 /Height 58 /Width 105 /Length 90 0 R /Filter /FlateDecode /ColorSpace /DeviceRGB >> stream XXֆ, 0#H$ P@ VYY k.Y$i {oaн}=M=5N~wUU^^G$KJJʐVWWs8+++iEE2(Paa!^DM"SPP@GHF&uP6uuu((''(d~#lvVVfffrEp0;;-Q:@w߿_RR@Tʧj(hyyyhFhڇPX!?2'񹹹Wx]QQD?1?=ҪG:{6ؘ"UϞ=CVd䷚`]~~ τ A_!D32 g~: A&gM4nDD/ ধ h.ww}Q_CLZF $>ћ z0⋖SV]E:.d,"ɘ;ubwjȪL*礪 L bOQfx9;tA5SPPӧ nQ͢#2Te9xPEY6m~T3g%-r /= B@.HHI g4!IL'ա/ɧrr (6IeP9rz/:999}}}7dzm``{E=?\_P=s{ml,wV39zn[H~[nFFF/d[#GD ߿?򆆆H;/11xMe ug*΍u /?Jڹuah)%Eա~!,25 ŸF`D//ΰF/Ӈ:qDCCCL=z:y8!jr$s}TU2n[LMM 0cȐ!&͍Qd2Q>u ,GĆHtDǎX|DZo.]tC+!!_rJJJp%Pq ZN]cn喰bXH*--Ea L#`ѷ觟~ Ǐ߳gHzyy!&{1~ !#$ԕ޽݆ C@X@Ѡׯoڴ֭[wK5 lX+- :M%TF9=vwZhby\V㸲Һز0VyHB9IR*pPQx ussܼyԩSѬ8A]AL.A%dHJ<&]rZ@K<k+:Sa^ؒw8V)@PNcMݒĎ=U9m;SeV]t m۶mڵcƌ"**6ۤ *ʝ*661ʫ|SWUUZ\QW[TQ! ZhsX0Lvvv(8P"GCIII'*B*tfiɫ v`&8m[-i鮮 NU č'&8lS$K422"*ݾ:w.*7B׌=^ ޻ǽu!/䳲6@WWw&y{ĺ7||Rw{[5NRJ#V/`y˟,\dKo,X{J >***X"pSRlnZ75MJa Qhvٲeh Nr2eʊ+&Oר :''1E7dWf]tÇSA ~Q~_y_n7hjggv3DE[u΍1DK߾acvwanaaѯ_? b^FkSh6.3Ҷod(q5 Q .!/6MWнy bḀZd0c Z[[x1 }Sd=:Lvv͢+E-WSYtX 5Չ'Z&a#hxԶ%qm-[VƭVV.8aȈHHH! aQTderr>; o T֤Iȿh#K6K:1A:|wwSjjjQJ}cv ӹ}4EpTTT&&atÇ YJ嗎VMg%PXWVU]~S1iILPan+L L F+H6F'!Ňteee2WpppTTT1Nj~.ry_ɰF,e2K2C/>$cDVVv6ItjNLLBE9\ZWo,SRd˗$/*Yg#⺴Ήgx80li9`׶zt1NiM9~:11vc簩ЙW 7G6\󸒢6Av'jZ]:YYYwz^XGtS#J8u%+Ro~&&.>GExO*,,ɲ2n: I2ɢ2d JW0jW0eWM1qV֧NUVєz !y=tM?"8 [,W3:}?.n,$$4 QzzƗ}1?{ W{vDt#tzjk(Kh*\WW̌`)JuWWc8pPcҕk/^> _!!OݹI;_CO22 Iu*ˌ'=s ?:Jָl|ϭ]Xrw"vb^*;3#RXV\ёkɟ/+uu Գb;&Qe(ӷ"<2 cK.L`urN#ZﲊKJsr32SR1 EX%te;I&JDJ̝g7mv۹kw`+W3#>lqvmZb8,,*BLG7~<аI %Ĉ(O+d'!.u(u[m Zm_23n#,ZZEJ0T/_5w"{{yg8uݱclN\ % _5 ?_׵ػE7Ӄ7" 0o߾ -R\D=d~nZ7v'o}u|U\-sUۡ".'ǁ!aU[K=&ؐ[ܨ""",6NoѩӧMxyA25 M}4gM7?o7aPOi4?;䉋W9rl䯞r>5'}vسۨ./I#@HJSGO46'zwpC?Ofg N΋+ p: +]sr2xoUmv5A9?,u(Ԁ ݀mX\)u=z=~Jr 4娗jF]MLd~St"D#TYYYSS_hQr|BO>~zJ("ǎ**cb.k8a-J*ʰ#Uz0_yLNb4JvR43nPۡQn$kx!=v"atҒ+""+)1ѯ3TXQi ʬʩ C8PT)VWOw抙y`BZCCC/ a<Ų,Bvu[8QEܐ bCN@.[NK & :mmyQHh[mݳs5{^> Yq/UkJr-| 36n7 PTh6֑IIY77o߹}^tL;w_߼u'!TM yd !l@3/ʲճJݝ5\h1+˲ֹ,mF.[V{yyqutZF 8`^9&ss^x6`(ݻ *7B] PbvU^_PmҖ%;H~;Vo* c:TpYbȉJt}aW49d2a@%//FEڍ./]pHBB)B@Ê)F%\5/z@GE/"ե)}K7v&D.% =g///\,ٳgO:/Iƍ7iҤ"al:99e˰>9y$^ܾ};>8::͘1%>>>6|*n1*CѣGs^@nnn ,I h})]#x8`0+t,"" [zQd̙W:u$hoP}>} (/_]Tz{~?AQpZ~vbٯ^=䡏?еP%a^Ge endstream endobj 90 0 obj 6379 endobj 32 0 obj << /Nums [ 0 << /S /D >> ] >> endobj 33 0 obj << /Type /Encoding /Differences [ 0 /hyphen /P /c /i /o /z ] /BaseEncoding /MacRomanEncoding >> endobj 34 0 obj << /Length 91 0 R /Filter /FlateDecode /Subtype /Type1C /Length1 1407 >> stream XmSyLgj2J|_=&(q(C8Td(ȥPhQP*R׾\UСrI `cShFeűCٲ?;x,㉶Fo NZQZ,QIs$mY|ug >ҔՇge[ؽ{fqmϸPv\!َpfGMxxnD0G.0B_ٽG-N)Ve*DmJ%lILT+UobqR5|-%'K,Tf/'\. -d2UL/^;3(HP'T831ݚOم[]kc/}mjqONY7i`|ڄf8#glhNɥ`2fRe2;:I iw:rA$ qjBFPHJb|,Y0tOa',K_PeHc$A蕕# ]9 `A|[s!5%ĩo`t涴Htx-8 xAB<|plF`4z\J$DҐyZW]Q= F=Q̾K`3H{nަ31J0=q1Yek ij66OG4чlDՕcv ˂ Dr0M0N [Dm'λ߬> endobj 36 0 obj << /Type /Font /Subtype /Type1 /FirstChar 0 /Name /F0 /FontDescriptor 35 0 R /Widths [ 358 769 242 168 290 279 ] /Encoding 33 0 R /LastChar 5 /BaseFont /OIOAIX+EdwardianScriptITC >> endobj 37 0 obj << /Type /Encoding /Differences [ 0 /space /hyphen /colon /F /I /T /a /d /e /f /g /h /l /m /o /r /quotedblleft /quotedblbase ] /BaseEncoding /MacRomanEncoding >> endobj 38 0 obj << /Length 92 0 R /Filter /FlateDecode /Subtype /Type1C /Length1 1275 >> stream XSkPUU^ ^ RM lb"Au/˜1I|Q$\DAl/2 +hZup0왵ko9#ǹݼՙy%cd-9꣣>z: kfٸL##qڹv}!mn^|9uql-􉔤TKrqNYe5{*k~n^%"2r%X9d)YKV $đd" B8CH,H֐|2oDxrLq\94ni4'LnCSW97cnkCAH O Fq{qa}᱉1~f-i-x=Xۙ<hvBxBvI xMeU`Ka%AQ/V\1Xf ~`rEm9YU%Xah8Yi oF6KG34(HT 4V)fd%g' i_LюRk i ] Tq_zvSiL.fg {}B/wI7&>0{^HC/3^A . D89F9h G =BCYn>sYf¶l6K~7 M͝e>sG qqC-uV.^,x\zlǓPpaUj7X䭎hl@G\*bKahD_o,`]#lM(Z.򿇌mPo d endstream endobj 92 0 obj 1106 endobj 39 0 obj << /Type /FontDescriptor /FontBBox [ -113 -250 1276 899 ] /FontFile3 38 0 R /Descent -512 /Flags 34 /StemH 0 /CapHeight 1841 /FontName /FVEOJM+Bauhaus93 /StemV 0 /XHeight 0 /ItalicAngle 0 /Ascent 1841 >> endobj 40 0 obj << /Type /Font /Subtype /Type1 /FirstChar 0 /Name /F2 /FontDescriptor 39 0 R /Widths [ 250 223 378 481 332 515 588 579 554 344 577 535 290 775 559 321 639 639 ] /Encoding 37 0 R /LastChar 17 /BaseFont /FVEOJM+Bauhaus93 >> endobj 41 0 obj << /Type /Encoding /Differences [ 0 /hyphen /A /B /G /I /R /T /registered ] /BaseEncoding /MacRomanEncoding >> endobj 42 0 obj << /Length 93 0 R /Filter /FlateDecode /Subtype /Type1C /Length1 1537 >> stream XSkLWj,";L+FԀ +TyTDXp؅V"XmL). ciPŪ  j[#ƶ16ijiIgMlwϹ|cY">ުٱsELF./Jw@cN6숎py ՘,ItWRC/`H)> ׹'.7K !-pX)/hWɩ:#c,[)9?A+cb1 rު?ϗ5iyF3ue[r8NaǼr,9;ހVbu8떓S} Xf, v0hL lUh+JiKbt. y7 WC"w( *xw?0'j}y T'{J sfK :-3zSJFtŒqӭ&Z9RǬcg֖˜rf-R%R |٣-@!g w4:XX-8}Uv_O fg 岝j? ۤ,NJ3Rgd.*.I+bВqdW OM'Bba/"S'Î(2M znyV#5m͡9[}!7 GKB A!a- \ |&iџF}3yʙusԤ#T4q֊ƒ:s!J7wzͺ[ 7=6lTw~ !+L4z`'Owf${# <G,D7m'&k[A]ZGۂK4Sjm6W|hh}2wQp_5k[}ӒJiq7^׵j[ BV#7>6 A6K%3O48󩲆g* h;FM8ce;{7'd{[UI+g=X_V[l)bJˮ6T.1M)%0JFd zDtpzfLa팕 >-5y)Gw]d쾆Wd[!xZP/WWZMwPY9F4QpDf:fEFrC竁E8gsc@{\fm,4dœ p ~AĨΗ()n*z"pkdq+DHa5^@43 |;j4Si4͎LM<~J/βp+ Z<y֑ p\/:uP~sת8#_K ה8PlD:wޱ<`?.Vr#uY !,PfaWh4K5UZ)X?X endstream endobj 93 0 obj 1426 endobj 43 0 obj << /Type /FontDescriptor /FontBBox [ -167 -216 1009 913 ] /FontFile3 42 0 R /Descent -442 /Flags 34 /StemH 0 /CapHeight 1869 /FontName /LOERPQ+TimesNewRomanPSMT /StemV 0 /XHeight 0 /ItalicAngle 0 /Ascent 1869 >> endobj 44 0 obj << /Type /Font /Subtype /Type1 /FirstChar 0 /Name /F7 /FontDescriptor 43 0 R /Widths [ 333 722 667 722 333 667 611 760 ] /Encoding 41 0 R /LastChar 7 /BaseFont /LOERPQ+TimesNewRomanPSMT >> endobj 45 0 obj << /Type /Encoding /Differences [ 1 /space /hyphen /period /one /D /K /N /O /R /S /T /V /a /c /d /e /f /g /h /i /k /l /m /n /o /p /r /s /t /u /w /z ] /BaseEncoding /MacRomanEncoding >> endobj 46 0 obj << /Length 94 0 R /Filter /FlateDecode /Subtype /Type1C /Length1 2610 >> stream XuUkTSWpEIxDoXQ jhU|VG@(1 ZobKjmc*]mTX3c5b]3cY7{sw1,?\|xGNvzn5-1,,1&IqhFt>x0N~k4(Xx{f#=͒mx$eaܹ3 q&{ٰ6?+ۼ%˰–bwdIfӣCjX#21gۨa~,C!ۑd2oIrd쩆mLsr3]`Ht&]nJOrs 2LdeMYV01L4(ǘR&Y,gf3Jf=3`f1392Yf-y<Iş*CD" fo MZZ.,ҡn=hfӝwλIl^,J\}MT @eZPK?@o#<0LJ)*>P!-qӲ[:~@ 7*08(evc{xOMשnw12(_Pe)/X=Ahitku^re<%=i0usC<]h2K4ecJ}(Ô)+)=N pUɞ!{$#0Q0<1ǥ'Y#&@:ʉ,в)ZJV:BBJ$ 4(6=Rzp4¨iL.Tc DZj5^u[Ƀs/Z\ˡ};Ž|M3G'nޝv3.ǹ!tQA衧ڣ9UH> .q p*MC?엮*6TJCF 7RvpȡHt"ܤWY0biYE)'m,*؏iE҆Z0 v^)VI*+9'al9KϠnz,EXt3czn䓓m\|I7z(d{]Zzp pUfn9mp]4L|ͼ*G!~؁Arͮڏ72j֯|;X!ښZQ/ sg;YC6~k/]۷n= M'{pdvd0[RFX WF(Z <>!ӁѪƅrFsR|⋹zگKΔyeapfwԬ1YE/~MӜ(ot_/_!("|-8{!Q;Np9KB~옯yC+s!@}%UO` ǖ*zHd endstream endobj 94 0 obj 2294 endobj 47 0 obj << /Type /FontDescriptor /FontBBox [ -112 -250 1000 940 ] /FontFile3 46 0 R /Descent -216 /Flags 262178 /StemH 0 /CapHeight 698 /FontName /PCTUFJ+Frutiger-BoldCn /StemV 124 /XHeight 762 /ItalicAngle 0 /Ascent 750 >> endobj 48 0 obj << /Type /Font /Subtype /Type1 /FirstChar 1 /Name /F8 /FontDescriptor 47 0 R /Widths [ 260 315 260 520 630 574 648 648 556 500 481 574 500 426 537 500 333 537 519 260 500 260 778 519 537 537 352 407 352 519 741 407 ] /Encoding 45 0 R /LastChar 32 /BaseFont /PCTUFJ+Frutiger-BoldCn >> endobj 49 0 obj << /Type /Encoding /Differences [ 1 /space /exclam /numbersign /ampersand /comma /hyphen /period /zero /one /two /three /four /five /six /seven /eight /nine /colon /question /at /A /B /C /D /E /F /H /I /J /L /M /N /O /P /R /S /T /W /a /b /c /d /e /f /g /h /i /k /l /m /n /o /p /r /s /t /u /v /w /x /z /adieresis /odieresis /udieresis ] /BaseEncoding /MacRomanEncoding >> endobj 50 0 obj << /Length 95 0 R /Filter /FlateDecode /Subtype /Type1C /Length1 4999 >> stream XWyXW!a@ (@@TPHK+^V "(J-j6kX7|'sOB}&̜ə[=CB$I&4hF€Q323ic!|>/#6@_o%juh A>弫_0B@yO(RRץ%'d8qq5?6e)t]zru䘔Ԕ eJbLWeo]sJLwvHUNKrJs.U9&@_떂g3W'&F%*߭HIU&+c>~/A"fAB+1 pb1p#,1#gb1D(yl"}at†K,&\'?@11  ;BF "`b)NG#"nc!%Bll#qL#W9d-jC Ye@.4  PC-Cj{@QU{Yz`7vl{kHM{KwK 0a+$C)p崆6Iq;.]0sL4c)Lr{ʳ4铙;w4%GJdSLӂSoս,.RJuQE 3@ N:{͜A] Ȯ@\ey"t@!fN.ݤݢ#g.מ o?Qs}]K=?ȭ5w]>s~K ɝJ ,J^ :ޤK T(8.W4ѫxE,W$D&7vN`4✧T5|_#N2\. k5|vQpBe4 /Cdtݭnieomgs6do˒)4ˡu3"4jYcѸs*]O -!_++F6-ob*F,|椌jO5|ިs VFlY䘢ob;@8< f 쿺Y@H7 Mheڮ@y&`?ߠ0^{&jym)xy n{8F1>Y!\8Ih$f9mE_N \Ev }|ؕ1 9DDeqyx^uK~,--aNga ͜9 ql4T)$!nxu[gZ9㭋lOr>Rqqc?cTE^:+3yps+q9AP!-EB3{`4G{(a\,0B;c Y"T6@W֤aFd>=샣Pޝ#ݬ#q@m&c L /lbfH[]R&gGXDwQsOv fXzK[ .Y15c#u:w齶M|͇Bv|34-a .,zt]ñXAHj:ks >~GǐEYX>ТGx l Ya$,5 A="/4Q0vc1jG/_=u)5A^'artt80~~7N~n݌WJl Yo'&A=&.3Ւ=AAH4 ٯ D-^h 7V&H~}| "nɇ7;Y+QS{f38'$<3@`oB_l㓣f j$dt`xB2^a{TxxKxvjŮh6z7jBpʨW .ϣУjfi62 Zu>o9rX hP;EttWţdž ?|h5n-[*+S?xBxQ/wG(<}ʔ#['58Fب>9(P CCVJP y,4H'X茰8 g1#ŏa{;D Vv$ ڨ`MA~QQ.ŴBf^?^r_7Y0= LКGZTOّ 7, _\0H\'enDFJQ.,fT>7]L)IQ׽KΕjnJ 0`<=JOVr)I!٧iar`~dqnHO3\>| k_kjd G w|DW Ƣ2ᾚu>b,#mضg>=q*J`^o* ap`^@ԾْҏOsiE?&K)2DO+M'wLcDO̾F_o iU,շiOsk;谲f;WFdZsZ$j o!K@/8LkEh mbpRg%&+ޭ .sl^Sq#ۥ ˸I+, pѺg-+ qpGY-}Q Z[m #5qϐ!ozWr'?j~Tsz}J#$!71Vl,U EiMOs,Gׯ:> endobj 52 0 obj << /Type /Font /Subtype /Type1 /FirstChar 1 /Name /F9 /FontDescriptor 51 0 R /Widths [ 240 352 480 611 240 296 240 480 480 480 480 480 480 480 480 480 480 240 444 800 574 519 537 574 463 426 574 242 315 407 778 612 612 481 519 444 444 796 463 481 389 481 444 278 481 482 222 444 222 722 482 482 481 296 370 296 482 426 685 426 389 463 482 482 ] /Encoding 49 0 R /LastChar 64 /BaseFont /SOEOTH+Frutiger-Cn >> endobj 53 0 obj << /Type /Encoding /Differences [ 32 /space 46 /period 48 /zero /one /two /three /four /five 55 /seven 58 /colon 75 /K /L 83 /S 85 /U 95 /underscore 97 /a 101 /e 104 /h /i 111 /o 114 /r 116 /t /u 121 /y ] /BaseEncoding /MacRomanEncoding >> endobj 54 0 obj << /Length 96 0 R /Filter /FlateDecode /Subtype /Type1C /Length1 2063 >> stream XeTkPW08m`lL**S"E-EA@;jd!Y%碂 Q複!hda(h&eǔ?Rsn}}Ρ (;6):6v[~՜(DhE83\ sI˥/ǔ; ѓz#LkzB]c.αZv]hg4r3iY jeEXH|}5Ӧ_cN˳f227r̹sJkNb~E( ţMh#ZX 4䍦#" i]P0:S3)+uw٥b-* 5׷\zt/ bH| :XJWb+x>i qXⰊ%>,,aPIw@%۸{-׏ *,۩ˠ'.ث%[~1V̳aG{1Gs0zo6-z +=2". ? +0M !H`-KFIyTp(eF7Y,0,&pJ<8Q߇)@s}ŅD?y`a3EGT"+F`I۸9;Q$Ag??F Pwcigx RLRlLIv0]мQ;:XDr$h?LqBrKWPە{KMu1M_Q $Xk)ёwsd.&eJ(M 0zYiN6'Kts&yZ$5$4gX6g7Yk2阑$7dhWIJl>Wg=RU`7TYdWęTeKҽ҃'v%K1Z !u}Y`"orͤPP*l߻×+>:tP%:XQ~fwG=;ŀn PCQ WXc &UX&U#O˧A=;O{MjA~49%}7c} q endstream endobj 96 0 obj 1896 endobj 55 0 obj << /Type /FontDescriptor /FontBBox [ -48 -288 684 841 ] /FontFile3 54 0 R /Descent -142 /Flags 33 /StemH 0 /CapHeight 606 /FontName /FZBFFH+Courier /StemV 50 /XHeight 621 /ItalicAngle 0 /Ascent 629 >> endobj 56 0 obj << /Type /Font /Subtype /Type1 /FirstChar 32 /Name /F11 /FontDescriptor 55 0 R /Widths [ 600 0 0 0 0 0 0 0 0 0 0 0 0 0 600 0 600 600 600 600 600 600 0 600 0 0 600 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 600 600 0 0 0 0 0 0 600 0 600 0 0 0 0 0 0 0 0 0 600 0 600 0 0 0 600 0 0 600 600 0 0 0 0 0 600 0 0 600 0 600 600 0 0 0 600 ] /Encoding 53 0 R /LastChar 121 /BaseFont /FZBFFH+Courier >> endobj 57 0 obj << /Type /Encoding /Differences [ 2 /four /a /b /c /d /e /g /h /i /n /o /p /r /s /t /u /w /y ] /BaseEncoding /MacRomanEncoding >> endobj 58 0 obj << /Length 97 0 R /Filter /FlateDecode /Subtype /Type1C /Length1 1638 >> stream XmLSWm-J/o֍D&f  nbj֙Lʲ7œ8 #HK?nYKv˾ۜy~PO(ZQ17t(jKnZ>,JH-^VkaekŪ5G|rU;o 6u'ٝm ;Vo7͖>y7Xy#j{f,7F-E*_H֡\2zP>F,*F9h*B)1>~ȆT 5( ):5?Zz\Şuti>WtyaDAO&ɮ[텝Mt[*zHC*Pt];\# 8%b D#,A2zA줈+e9)Bgk; =@ gas R0"#KO50{==]R>`4t}aQFF!kBC+lrR OĐogA-&$ cq\O~Ēdw^ޞP&iY۰iDr?8X!TfU7BV(بLmLLѣ([;1`prYwf\YGY QRYs2{3j;_t;E8ͱ5 endstream endobj 97 0 obj 1392 endobj 59 0 obj << /Type /FontDescriptor /FontBBox [ -79 -198 1064 825 ] /FontFile3 58 0 R /Descent -198 /Flags 34 /StemH 0 /CapHeight 628 /FontName /JXNRLQ+Insignia /StemV 104 /XHeight 641 /ItalicAngle 0 /Ascent 628 >> endobj 60 0 obj << /Type /Font /Subtype /Type1 /FirstChar 2 /Name /F12 /FontDescriptor 59 0 R /Widths [ 520 612 612 537 612 594 594 574 240 574 594 612 315 463 296 574 612 574 ] /Encoding 57 0 R /LastChar 19 /BaseFont /JXNRLQ+Insignia >> endobj 61 0 obj << /Type /Encoding /Differences [ 1 /space /comma /hyphen /period /slash /zero /one /two /three /four /five /six /seven /eight /at /L /S /T /a /b /c /d /e /f /g /h /i /k /l /m /n /o /p /r /s /t /u /w /y ] /BaseEncoding /MacRomanEncoding >> endobj 62 0 obj << /Length 98 0 R /Filter /FlateDecode /Subtype /Type1C /Length1 3162 >> stream X}VyX2 ($L\> j E%HP=(XjV ю-"kQVҪ3 ~|w{GBPmpذK#f'.]BIg}%%b_Tt;cu83:Q_/m\q+%HOMΰx-֌8q/>5N 6d %iL}_RfuA3Wog"oOh4x}.c&5A3;1%53;M?b,ѥďL%3z8Cb|.#Qo d5Ԕx}A'DIQ3Pj:5O͠¨ QT N1T5E-FP$J9Qr\T5 PJ7Lͦ)/+J,jQ6 61㶽llmɆ2eedwi%N/7џЯ[m{b=k?`s\LL,YY-7A,ҊQ[@ƴvJ愘J][XJ洵 Jߩv1?a]<?zD\tF#]limYE W<,ظnGzઠ)J&Eܑ;c$5Ij̰, 2<Ԑ`x#2\-xׂ(AFozޜ3 56M\ox k&k&))eӡ 8`ȜoX0C!2XKYX9_} T~Prb]UA.64>{E@0 #q "1"pha#!([R5N~e}Nq0x,>}s [>)ػc1aqVMŮ AOP^.?[7.26jV A Wtԑ@]%/VtLƙ?cjyyD&eɝ:w=]qݺ I?= kLMU*WE;M1e F13W1h@]e58&, >GKh yE.hǠCƒgˋCO~;}tV=k-HO%, ]̓-)FA.+mnC85D G@rz瞃5Y *| ʯk+o}8вqP7n fe)#͒&0a 3* wIbDLAH4s0EYJ]wswEM ahgC7IKUfoisdmv啨;Jq+>ii'>A֋VzҢӆХEQS yK_Sigw'O&yYtm*ucIB+ h#IJ,&'.ѐ3 U*i7KݠV,#0I G ~?{|*[PyGXAu-i(~|areA/Hf57M oxU=X+eJbwP^ǫڎDLþ "\/ZIjK ḵ2vfKH I8KaL'GGcL )M1 p_ i`TLe,ݙ\oGA (>Xp`8R˕Pdn.ah7<>rh*hЏq!>\뚣aest')f_.cv_pUV9Vq˷!UO>?21ofS *~`;v/y l^sJ[?A& *Hh>(e>XgV.8*5h 6 ؄nj#D*&i0~RƁ')8ŀ zSzpb3 tA#{V]q{=`Ex<  LsO_`к{t,;2E[Z}I:Ñ*wq,H_7mfOcݕ}3 AvͣWnwrV}!oO?O5W(aULdW4KK-JƿV-J/tb!m%TrKr,=vK[^+e4Z\d9I` C:˘ߥ]\\~(<0';(+x4(GC9{C7tbfx5GZ'ceLdlB%1uhb6b XckkV*i̽DQ^m7@$*Z-Iۣ3*Lf|-fMyc)WS 7!d..jihAv^iO^\TF;-!8p!vHnr19: NmPG{0*-,w endstream endobj 98 0 obj 2798 endobj 63 0 obj << /Type /FontDescriptor /FontBBox [ -100 -250 1000 913 ] /FontFile3 62 0 R /Descent -216 /Flags 34 /StemH 0 /CapHeight 698 /FontName /LSEQMS+Frutiger-LightCn /StemV 58 /XHeight 762 /ItalicAngle 0 /Ascent 750 >> endobj 64 0 obj << /Type /Font /Subtype /Type1 /FirstChar 1 /Name /F13 /FontDescriptor 63 0 R /Widths [ 240 240 296 240 259 480 480 480 480 480 480 480 480 480 800 389 426 426 444 463 370 463 426 259 463 463 204 426 204 686 463 464 463 278 352 278 463 648 370 ] /Encoding 61 0 R /LastChar 39 /BaseFont /LSEQMS+Frutiger-LightCn >> endobj 65 0 obj << /Type /Pages /Kids [ 66 0 R 67 0 R ] /Count 2 >> endobj 66 0 obj << /Type /Page /MediaBox [ 0 0 660.28302 362.645996 ] /Parent 65 0 R /Contents 11 0 R /Thumb 10 0 R /CropBox [ 0 0 660.28302 362.645996 ] /BleedBox [ 24 24 636.28302 338.645996 ] /Resources << /XObject << /Im3 6 0 R /Im1 2 0 R /Im2 5 0 R >> /ColorSpace << /CS0 8 0 R /CS1 9 0 R >> /ProcSet [ /PDF /Text /ImageC ] /Font << /F11 56 0 R /F8 48 0 R /F2 40 0 R /F9 52 0 R >> /ExtGState << /GS2 4 0 R /GS1 3 0 R /GS0 1 0 R >> >> /TrimBox [ 32.503998 32.503998 627.780029 330.141998 ] >> endobj 67 0 obj << /Type /Page /MediaBox [ 0 0 660.28302 362.645996 ] /Parent 65 0 R /Contents 72 0 R /Thumb 31 0 R /CropBox [ 0 0 660.28302 362.645996 ] /BleedBox [ 24 24 636.28302 338.645996 ] /Resources << /XObject << /Im2 5 0 R /Im10 21 0 R /Im4 13 0 R /Im8 19 0 R /Im13 24 0 R /Im9 20 0 R /Im7 16 0 R /Im12 23 0 R /Im6 15 0 R /Im11 22 0 R /Im5 14 0 R >> /ColorSpace << /CS1 9 0 R /CS2 18 0 R >> /ProcSet [ /PDF /Text /ImageC ] /Font << /F11 56 0 R /F8 48 0 R /F9 52 0 R /F7 44 0 R /F12 60 0 R /F13 64 0 R /F0 36 0 R >> /ExtGState << /GS2 4 0 R /GS1 3 0 R /GS3 12 0 R >> /Shading << /Sh1 30 0 R /Sh0 27 0 R >> >> /TrimBox [ 32.503998 32.503998 627.780029 330.141998 ] >> endobj 68 0 obj << /Type /Catalog /Pages 65 0 R /OutputIntents [ << /Info (Quark Generic CMYK) /Type /OutputIntent /S /GTS_PDFX /DestOutputProfile 70 0 R /OutputCondition (paper print) /OutputConditionIdentifier (Custom) /RegistryName (Custom) >> ] /PageLabels 32 0 R /Version /1.3 >> endobj 69 0 obj << /CreationDate (20100310135738) /ModDate (D:20100310135751+01'00') /Creator (QuarkXPress\(R\) 7.2) /Trapped /False /Producer (QuarkXPress\(R\) 7.2) /GTS_PDFXVersion (PDF/X-3:2002) /Title /XPressPrivate (%%DocumentProcessColors: Cyan Magenta Yellow Black\n%%EndComments) >> endobj 70 0 obj << /Length 71 0 R /Filter /FlateDecode /N 4 >> stream xĽMnIrVCN ˀ^6h yUuoߏw7m7hH aS2wZzg/ l@^KZkAƎ̬yH8YDFFFF<q{|'?y[ݯ~ï>ݿwws?_ 4w/~#_'QOI7~?W?WWyww+G~_ӻV~?owm#~g?Wů4~?Z~wǻ%˿O/7_||_Wŷ?O|i~|~/~|ݏ~?ۇoW_?׿˿GBo~||>|껧}Ͽ/~?矽{oW~><ɣo߼}z&佾|ݫA?Ϟ>>s)`̙3pf%4&4I8ygX\Smcu{sQNۛe+&cM^bۛ67u#e,noX{.ɷ]Y.`̅3=)jc™:vl_ju}ϣgn2l/8?<a2xۗy:}Y&㼻j޾gu4?[/*<1}X0M‘>,L՘92=﷯\6|ޑGؾM0NSFgy*MOe*O׎}U&izؾNl_li:ŽLs מ7 \>{OeU۾Uw{uu{4=?M/yּ-Ӄub<{bu W?湉/9?1f~uzkoxl_b'>:N?X_AM?@EQ;Aܾ.Ai6""o_ EX/ @(JL?;ӕ1ALw_ ;k~9<|~ôKxx+xxc{w/bٿsCE,tE19ooK A1[?0>"oC3e{/>]Fǻ|/.r-jVځ}<S4K0Yǝ Ue.oosac!dr:|+ymư>dz&ۇ23CFV}8.jy8 _8o< z8<ӁB B mư>'}/qhJNG55pM}4]SnM 89ŝNQ>U8ƅ{c뜈Ƹ_p.6e^]nN}PTѳ2*>۫7Qմ2ӨtyTX>,<}ýmrp0뮁-7 ýo_1*O>:,<{l D´sy븰ѭQm2,\{miX2އi,p1}=1*\{2 מӇa?˥f ӞK1.l{r0EI;_ƅoon6^^&NxƽIBDžuoK>0/ ?+yXɬ]a'zee}r efy\.B(y\hi\~U330o30oQ4po4oQ5o5oU630p6oQ7o7Ӹ$pqaݢqqݪrfaެsaݢtqݢuqݢvqaߢwqߪxfayqLUUUUċ)&, Og2x/g-g֭g&g-g-g-g-gg&> ,gG3˳Efyx?.wbƸϊq@#.6V`l Y1.bcc\g0Њq3<6 7d@ߌ a"iFl g6dcȸ%Uƍ0?d܈qT3P6VH2nA+V6XA ,4e@hъqa0G3b R͐ F1A fBXiEƸp 7I3p6fl'٠VZ>.7jpҌ >H3~6vmP+ V!A!chBi0ӎu hmG^@2nDxq#6Ɠ1e V4mWi+ rA ,4#j@hъqaTG36fXm#͸ NځA!"k}\/ZI36fpm# NA!kc\8ipҌ bH3lBXiF gL;6(vmP;_ i`P 5['`r`t`v`xz|~``$`aANAVAVAVA^XAV!AAAaAN S OܠOݠOݠK ݠO0 S@ݠSP W`]'x $xBvFA11nAFnAPA`YN !  +7(<(0ޠ3@ޠ;P C` CpޠG̀ޠK͐ޠK͠^$``$`<5C},5}<}L5~LC~\~l~l}!7h+{"+g  +8(<(" >SdPAR@bI$`$13 XkXk xk k k BxpЀfpPvpvdI\;P8HB5ܵÅܵܵC̵}!l8h^;pIp23 BpЀ/ BqЀ/A؇3%L8 Ƨyb<^cxF ;.Z^׬`s Nx& Hb`56ŇL6>̕f!Nr&#,-WA1N>ic6LN>icu' +f )g3yf p)-{f"*10>휅`: Awy, xY( ('b@ dAKU|0\B.hG]P6ZHGÁ:e#-鲓 tJ xd9I\]Bi!_/jdAxƸ|3A0>* wLKUzmxƒ"\Ǟ)(PDP,;j!; ?< } v ptQ Xשhxx쨅<]vB.;jOOnPZHuG-$`뺣f\ӎZ<L;j! wB!ߐ_>AA0洞bQ EżˎH ~  ?PˎZ(eG-`麣/ tQ x쨅<]vB;j&)?YޣA;j!WZHˎZhdXAA0mbS+EŴVZHpq*-7ɠpJA2o$dY+IɲV0 pv\+ X쮕]Jkes']*.Pd,`* XhÃ<]c!SWXH֋x,4XGwY>|LbZc׆8<fX((fX("(XHA, عB򱐀u)pJ|,$`* zFk $ڲtE,$+YJܫ*&+6?Xf̠e%cIYIUTV0ѴQ JҲҀqz[?ۏ~~x+<>~?|o}w2ׇW7O 7O/ vN~?x{KhޣN;l)ߋr/f >qY{10bϛ̜>ՕxK=Z{1`"·_˿Ct-ߋ4{;=n.Sr/-{?x;f=G[-{7_qIr|uxQW:$\=nadn>7}"׊lbT{\+/kq{H^N c#{DRPEq j>s; }IE8dg-W8J.n2#9lE ~OH0C$8-x`V-^HMS'PQ`A6E4xQZUo"o"|#K q<J2@D*7޸<~O3Mol? {9+ptG{eS@WMそon V> 5k__~?ӧ[q ޞʥB1|S7d^+r!;v"~757,sPQ(B[c8bToH3.5F;O4&۔3BG_hb sye:A.SáLECv>9c 2f-~8z-Y0f8T7/"r|9䱎Br%,.yNc3ܰ|P Jçfy*m8>Ջ=QG ٚ񗁙vb@^A34oľJjÛviS  *?ھC y݀xZ7B5ƱQ_n ><ēw5|yq>2,++_v;B&rpjTyH灟],wIȴ_nC4E=%_sZ8E?}U=E.ЌC`UK3SYvTQ R#1}=wN,_k>U}G{T~WF\x* EN&~2Ӵ=$JN8m؏eBILeaiO>ra52v?aG|qx'ãjcƙrħ1zY9(+1&7#>>oOq^ޑA?(l(ǣ@&VSHXtn)Z_< nA*t_=`N<8,[^UNƅ!ArlʅylH%/6Nlg/w2AV_iwR;^=pp"&<){PvYncgD |z La\ zf$o Hi "wA1BĜb6iG<p~^k-j,yϋ2 oo.'DĪ(hƦvs1@uUP~/*\9G\ȢZJ.Tyqj/=}Dw43IWxHVkSĉ*b6NԜ$}E jz*/kEKg8o"~9)8tI˰u^AXUܐe}ځge !iZwz#O O+L .!D/rOӟyo2M TDd+o‹d\C\iх3w`>ΕG@W10 thL&"O(M1BhT/W$w>HI;=`S9(?yA"/h7:nJ3aPG:Ry пxH.%;@K@^h±/B}FAauOPtO^g۷_ʽ pnP۾~ Lfy65._o_8SM?5:tS&? pU MB꼥Ԩf2" b͠E?Za2C7Dܾs|,D8"o_ 0zEJNFݘA?yz1fJgMUW ,"D*E/s Eew]3 Hۗ hޝ [][O>p@`Qeto캹UY J|"۰bBLjF~ׯ_<|dU$h5ʷ̉.3Ԧ hOJ3py{ rC]^T t=e{W b,Ԭdzf@n1G%5nD?E#9aGULtGz @Rk[R3B,1CnW'+Bp8 1ȻOG l{X\0&ARV$G38ʈ$宫d>E "%?.\NǁR KId2y+al'%-xyZWf6͇[u{.~ak&}T r>_&]( ӥ@TWCz_.οWJeƈnEtp|i{ЩۅHw2*aMaIkO! "H֙_O(znjI< ׅ H~'tlg>% ie+xl4D w^|! R98b{7U&™ U!dIGr탻,ԩrݜ:=u9)ƏI%R ăad@!L6(tz#QG5LK;o\a_4]T`yw. mw.<ɼjKTG9`o^n%ASUO"\CiBSiOoiQ2.Cpt0U eacաӢH$j|Ddnѝ%`QdsҜw/5QtΏ' ,јJA.qSz^ZNs$zfRO"\lR/@Tpai0o_XkPՈETG#i68LCHC!)1\nS0TOaU=/}}4.Sm3G+"9 _aU>Ty=VA@Qu g֤M}"CNԯt*XLG9e?`b z6#(m?xDsV\QeA ąoqTXuVxa5DzW 4}4b):rDi2"J&{dŽji'*7e 8xGVТ}79[̀fU7e>â)zeEA7 bP&ahsEjUxy4Hv]3?h|"=jQQ/T؇PjStzӭS;x{* >Zs;/Drv#k"EIj1W5.@i/!/`uU^ADO,ZZOzyFށ٠W? 1Z [ !1kXF_e&'N *PؚV_EfBd sڙ͔ sk6PK,5"V0'`8¶c`Y*rj5eIxD}GE- N0feaZuң] N;]Ph AH: ObubWYzv!j9<1!xf:9`v`TMt;ځgv:ye qɃ 0F}m7<3gȚg"fix~(TQiҨfKΒBGLpe<l `16 ̾bjNjĜ35; y}a6JYgmBe Lqd?2%DO#=؎+$x u o-_!׍pQ!EꡭSn e?)WJ H`Hl9b:G?PAU uZ}1wt躇%{D$õ:u6-Џs)zz޸ 3̆݉W9 A4&=!\ fGqe񦁞BOߜ`078!0Ӎe~x &bk^@1=6ݗohA8QL|(d`0Vr8<5.ҢIu<fwsC= DDĤ-lsQZhK`m=-һK@Քʭ!n618E]K19z7]wPnh,ķ=3Rɏ+Vz$b5[Py0!4kkI%L+Ҕ77)I5mOy I{K*4C$VV3u^q .du1nឨ Uqtx<2*h b^?BxE4ڄ0 >@~vcl׌ZفIf){ n52}b_fGΔZ{z"X ;Vt|E5PzߍĶ]KLHZDص ؘղ9Vf &TX%}E\owTxDBVx0#O١*_UR8g<v#F!jVٜ CKD ^dl`OL'vGS 85Dp,vقY"ŢQWMo"ΏIـvٙ,vY?ex1s*UՓȸhXfgv52Xk{{rp9MKfV-$p!q^ {G+| 1vb^!.eIDf8Vd~Ev$^0esuV8>C/;lσMh,;@4=heefYDQ,Vy 1"hGP_( a`jRRf{]M6#8evIđ-@ح6yO4oa2m-(-ID>"}v]4b'!$$CB>n՟bX/MsE"uoICb2 !>ԙavd[ E^jF{d =\Y;E/g8U1EQ⮽ɨ63 N{XkP@O:1D#xZUξc ޝeVPL+ 3;ϒx)-7H!͹'q]ROanp{ͮ.uN4wyo&`b_$P$LX!y =u ¨Mw8W{< 1Jh"S4"=6%2Hs k& ,U^iX)zժ -yG Dr+&=eTLXd W`Ya^:98D(~Azb< nV%6cu]CX7п38Uhf:=a@f{vIgoߘBb-yԈ;{6e%fSȒٙ fNJ׍ZL.̼dgfP&^y~z"#Xd99SJy 1Q>^#n1 4a0R<&;DIC%)ԂjWET&;2 81w:sFٙ>BTs$ѾXeI[\;Qk1s>,SW  ŹD; Da2xh÷SV-bDbV47 Y̱C ԃC~hb! @v.y, w[huj=6bѧߔ;# )*N-iz1ΓP f9[;?;MBն{k9+bkT*4dYxc7M'55b6zU\,:փ  h;Ms4J:XUFfq]-+McCE'`UÆ< 3n6WiN6(xxa,UDf/Y1BZ0C}^aM(S/A&ܱEM,p 0I!v"Xji&QXYgd!vxt`60 l!DlU^rKKD42L Skv9z$i6? ;8CZ3  ̳6sPH/q%ej'v0)o*8;&mC0KܶaFޣ1iUPfl]9/]D(y9tt&>8bp>*u1Ǵq?x) @.fy|@  4lX)^Fv*4j .f|ZEZ6!|,fv8jŶagr:hhU֢&t !Ba9B~ˮ(APYSU1SkZȪtevõ>lZ]`(z!c!6IXbRg C ä!v~ A=Ω2iqmUbC< +Ykܓf\L9ܩy)+- Vxb!zp]Ebk;A aZ/SnQy0Q_j1}ӱaf@寙OuHb$ؤ%|HY+V#b'!XkZ2(%)BR-6gcXXR=*]L94k=Π?"6`2-|Ha Ϊ£ _EV1?i!ѬK~FTCC]Y˭0 $&p[6X-Kb CZc*Yښ1Zו~O$5PTCZI%#6 xOc  p_l) SE{NҖ\ƬO%[,ZNȢ^b)x{Vl9rвߢU*v31ड़P< _b'fe<0r9d+vR ubz]D]) r<tKlVE@V؉tphs8zӃf$./x;R3v(Qy4@WXX1[t0Xww([؉WG 1B|  .`@HHSdj^!cI"+hO]A%V؉Cf@+,݂K؉!tentW;͡ ~U{ʅ9NshEm{ɫ-i#SD'#igML(Z9Ya-H&=ZjFQ3+<oC~)@ŞZ4hA)X0e@kZbng]}\f0$;aGPA ev,U;t=OĩC&SbP;,.L1#^K0Xpl@Ng'e?h,ׄɦK ܮ%ZڵeFƤ'vbT КYnk':,#eR[NTDiCkdIm rEך ` "fYSwiD.+óMT+mrÐ)p)AM=QdyԆ7evֻ>%d0J>4sB 2NVdp~ai"mJpcam JY+ϲ$Vi FVsV81њ> _CDJlߦw‹(nO~j:ҷP1S)uL(%gUpX_ڹMj۝N7@[6) *T6u &>V2eB[F(ʋ^c+hAH΄@] opf%sJl3h6"xΫA,Z"U+0["c3(UW(L'$ށnY;>MԍrW+}JԬV&E0)Qi)ޒU%Yy}"D3M@ Xx,!Q2*/ V{ $v\iCӈbPT3MB[CVdf7meSW;r[?=0Y%i@1HR9XZ3<TfA_CDL2B~ hlefNe +m)VVA5|eDBT9 |޳s"* 8ȩU9l_ZG]%cT;8CLp5h/ZDcVVp๦N&V3msmX-r@5*o".@E1*ۄIQTEU~0LvHsq<]kJəK,kUÛ96URGד3y;ʫvVHڬӈd"fb2mEPO&ɔ̬|dnG-IhViDlŝ^39w±Dfn0FP;:9luhA2jgVvSV@1U:",@֊Ԛ?̲wsO.U9BhP4"vj6y}ck/ hWHDN P)\ jK,WHNY2`ii5Ҽ>t/s JíB{N v8aƯ7YaS1 eVr=4 j@b䰲+#ڈ#4ju,քʮg` ޶kʨ ,?+ri!tI*P@9!gZl63 N gb8+UH7iLus P7\afeV~0Lumf ̰|ԴַŖ>8LZذo|"-M;aUj@ɪk1t8ʱvZbJlعa""jX;5-تܰp92,y̲@$!jfY>[iZ^]l @l^Ӊ++BjY>iykDf &Gp;rٷe!~+-V,Ǟ4v탤Z?&?ڊZmY#M+xir Z"f4CJ-C+ 3rXi!Vcdw5!jZ>iiL#nFkm$"Oε+#:fd$"VR.=Z \0-8莋[נ/93r1إ%ix!L|xl+>ΞO8{ҸnoٍT4jG/x({laE^א-)h&Z¤fPRKj&6v4"veLVZp׺A@%9;ݲhzH5LaT_ËFDN<qgJ$$*-Yh&". +pDt_ȷ6 ыHLc8 Fm#Z%AjʱuԀc {qޭaV V>PZ1t9ipk ARʺls k``GCĢV8.LbPV͔!f8ª<;j-u5&zپFK3Ncr`Kk٩`&_Y4BH̜z㜢=0 DLօ[m ,ˌ@Tqj @Q8Y f C NGkw5@`qz@+`ksğ"Ng`/5e:S70ͥ Y 8kF$v3szAiElLFFuEjÊՋz_ɘVz )7v6泙Qu0nc*~R%~L|6b) NiC;ö̱͌b^{Hn{f/L5s2EC_Ž=+(fVf#<sVLs͠ Hae)B^/1EhQL[c}q`)MMDԣtYfXnf9BkJVe i~DlzЈZSdbu3?srhMǫ6!;"a o734BVRTM0%XSdV?Q:E=dqVRvҁ^Jrnhyh6`K9҆r=3;uX`(g<:u4RVơei 嶓p'J$V_h|aͤBRt?͑I2TN^pc\~+)| tzؔ0BE3u6sby3s;*@z|<)' %PLg 7B3!^nsHlEy¶I{U4%Y3"WDw$!T^ v`PRUDR}[g9֯]hf>tڏԢ0pKir+(նg $ FY:4FNZQiSNN )JXڙ$H;snP@, 7m a{chiZ+>:s0r*Do;fɟCT赊* $1MזMS'⎵̔ @p%f"vh&4q;˒aOgd'\gձ +;uClW]7`@ McY{${U1@Sxlk]@xLE.0-ÐMK!ab :Lۊ -KIQB@~lne-Y*0`ȯMcGHj.T@x_H iߐDkZtduڤ+5E3(T7tFB5qZ}%YA6̚h*S3bF4*eVʹMڵ . @t_H ֜EL[kc̪/%vk.o]ʝ"ThI!1<554խZa=9tK_ͨYcV+$c_V# z:Vq%́r#1f,7Xn iveA4cr%#΀f(Wb ,{RJ9`~akpc\_2`Mfl^Szstf{ޛ⮨C4 C$l\Z$JrYX 0Cu|E(7e{?xMjډNڶ;hHg>웿a^F3BdLWx w'ˀ3=$$mÌ*L`HcZewԪaBx#Bܻ;XgjKAP:-9 Ų.zfif=hF3b^q99`1Ԝ!!u,S n^h>UExaLTb7C,~B弚?)*6/ZP+<ˁ5OmNa#Է5.'yܨJ졙0 q\Ԡs0h$l?Drb&[$7O'_<%jvv mjULѸYO":Zc$j]}zhHZhBBSfm˱5|oӔ{,ߩ5/͙QmA~^^ Q+9|ϭiQo.ʤ I,90kr '<"˻n)́|pMsg09ZD,'4 55@"=ϊϬo/{M`̾5jqLM],t"h)^Gz)hjmڌs--MU AQO1hJ'j"-G4uU87L̸:q4qp4+)xWz0;JGV% 񮴜[*7X!=P੢rjͮK3#B h'Mrfi`%ZX!q=S|K@qZH)i? $UK&-@4ekthPuUmW矼&VN~8=>VU<YIm t\Xg7s뭇.찑/ӬeElPWrXͯQ4C@6Z>zVͯBќAqG l=YXe;zB3 iWfO:ԻOWveo|LqT(w65 3DP63m^X@SYSS 9ST b RAgzRo\ⵗb,Dt;LxAp+4us힡1y9I) A}́xGd+6`Z[EE6}xB%.4 )>^gŵqS$ 5$y0kp圚WjU-5.An0lAu.SuϾ]X @Wc+Cņ1jazz '.'ղk, M%eݨ jߴ ,JX_ΪU!d 0DcCB7|n^tZGӚZ`YZ^fj..Ed~Tb1>j9&@ "R`KAUHvREYH 3 Xy9S8G0Y+$՛Rl@HדjRLe*=whW 0TK OTш-D,J -w U^Ϩyk{$YGփ f#< uEνڗB bVrDM ( ӟ^Pk &Tyk.2sozN e>]I e9i:&v rPͳ LAx`.ImKVd.$8D֣j=ֈvrIN#`I$v%ek%@,k = o8DrXߣL9ң7:<5I0r\Mh՝8+z\ϜbWvw"b[Q}OBjk$kC\Y8>I˾$+V#AWW҈p|`Z^2jh%&.g2 Ӻ )21BH?'.lǫ@ߚLB;kk> (`Z@=JH߉=Z@`ףk}#pj+8XX įzxM]Ysut~1f|nɊ-j:F rz-İ59pp*Dru.ެ.ӈ`LK,1tB2f@]i<'Ϻ-D_$mߢuoa"ǰKp"7J'=Nojj-g6ئ_՟ς[~t iL zb5SBW nF%'=f!YPܵ)ln*mt.L"3ipDaUouS jU X]I84];Aj,~HGZy[-E60biBVD= h^AZ ^Tm˙N_& P~8_i+wGSUAQ};C*3x$X7MԂ+W:G 1tPV:jA+:7<$yUhYp8t/mk9;`DT X1֤YEV}%tk5q}whnp4XP>آUajg&RW0QANcWk9Cϻ_8㪍s ƫ)$"Uvbr{6z}Cl@m-cmdԜd0 SYTO p`-DEW_(U! 0C;՟YOod>؂a)GK;BEzKUXmֺLDvB9^\KiB'`Xjݩj"'s@LN>)L ]K0QevMZc5 0dL[z;imyqMeH8kFz׸m+/[8ߨq6j(KjSYiV bQ >oVt赑yKϪ5%6b +t)b0X{s0.t[_nA&JaҖ]Jn{n`jSn!&c붣kw.'_d"֓#v!BK=]Z1h́*,1N&!:"^_?v+љmG?VAn"%:/hXi^> m0-T\C`~ (ϔõhG2w a$h\+ߥht &hg|7Aq{EB{6 GVv;3!]3詡StsTъԐ݆Ht#] TaȷJXa&-]ZS+Wn$hS.Xq.n#{K$Ŧ7-_.&>bI^^Z{0WHlb!6>p$=jpif8K'U&Mxx~k1Vw17`Ы q׷1FIȏ5ds@FmhD?HV[RȦ*D^FYP9FH#V3IG1\ =O[* ΂F -IME(ihA#o6o+P0E2+Z5ηܥJbpIEn lc"w(Rc ;>b:MAzO[zVGs9,TDgGl' :- Tڧ ab";&i5pKڻgC"*> ԪxϺ\hEg!";|hfv.5|JM@XW*AGv+{S ^3tl[L4$ D&z! O u # .l"y9 190SB!*hlE~3}=hGE Z{&tdrL4;xglY+C/jHs&`֛t qhamLѴ}η)0PM1NOuqh@q2fܵk؎xh ]ejmVmot@>I`(lcsr+ IOwIPҫ表?!˸\[$Ǝ豝!z| sZƌYd&D"̙ U60M8Yzh$/Ж X00 대h'. {),-8N{kTeC1 (kU^66 »4F;&s.å^  X3.:VXdIy0br)PBь@>),%X.k2:+p/@:k~̀) SieR m?7cBl#BpZfi{8h496O2*/', a]2WMa7D-tSN㨂Blb_g"7p`#FIjc>X !{3Puø8-'0天N0 [q參'>a8F\m{,uD, Fi&TjB&jS!izwi"O\F$qԑGU\g#5Z~~Nu5ج^#\!uڤ6ikbܨ05_*2A=D,CԆD+пS- КJ$z !.75QuWgqIL-hǼZ֗me>ȥbHSԪWW=C7Jcl )Q[I%h&OFT(p E׶OP1Syi i`Ptf!s`]qG_nyc*!YMg`wdVƱ+ܽq.y]ˢՈP&-14C-O4G>"2- *Ds4ǴǡW@ӰEKgtz"ރ'nlhys{a~װMo* Z&kֶ3\@؃,WXEw EK,oT,}u_0-x%ZYOc [d[UKS? &Q̘@*-nɫwV!Xi6m\y贫'8c0R\9`@U_,sz܆ me1',x IJV` X&#J' {@BA:o]P~Bk0DtUMod\ye b zõP+WNgC(cyM|hGI|9I(5yc6f:?ͱL•ex5Ri?՟n?B?߹~o_s_;'UCmw 0[T@PBJ& 0tw (-l>{guKqw򽽚o=p8"9Z{ȉ է' jd mtSW[/-~L|K'n N^^\zܵU6O%K^k>:>=.g? :Tvjw{ӐPX0ڵxUK#4"J#u#*:.{ *vK,?H\^F|MÛM g%$M%$OAnKL;Vnޛ1 ,dDՄ`pw8L!"((z ٌ`rppb|.AP@~9s9t9)::Ý]Hb9(YnSW=x&xRb{h4\|iߛEJ >\br7Jxw5k]>1&*! thnX؎8Q_o'O%$MOJ~r#s*(X-D-B/Ɩl(Ɩ>.s(,?XN(RR1TiQXeTU]S]ZQ#=^UwN^S`0)iҲzX|{mJ\ND.p;wfzAѡ=(!U[.sR/?)@@iU@GՀ/#߇$|g¨\˺q:";-QdHlTL⍴+Ș1؝aO+~{<榛؄5 ďIד&];SLRJRriKO22:AƠ"!0f@?as!qiEFUЬ,cS >Cx@@C!5ȕMz*)tE:32pۏ}cǩjr]< C5w 7{?⃴+ȑ #11i?zlqbݓ;OMO}.ekoV}?7kc4bbƇ?}~sBWUbc~RiZrvʁnTb,>#,1 tlCPt {w F|F",Phe4 csq`y|7A %*3oH~rBR4oZ7݈.gaߙQ,gV[-(r w@ϊW?̧ 3[",z/I$/V({Ә;["\^ShUX[t(HD_Y\WTQWZ\sFV{6D]޿kPm7l7i675komMjsԶ-ݸ}vOν%b;^NO_oH>Vf@A?>4߽twLF. M=L}QcfxrIKO& ώ?kx~iSJS/^433oGyc߻]}PPOIL oߖ~_=e+V&'QWo{55 WNOE@ϝ@:|jq JB!ԗB`S 0?"Ԑ.,- 8 1$cwbmz j uب(KD0JCm1fΤIVIבD{*( ?2 hֻt s|9%~kȜyT >w9J8VegZ3R!ɻrZ |v}-_hln%,IAΊ\KN2`\7L$[9jEpK3pG-djP\]yp.ӗLn_>Tf!]A pk-xTѯ,#{bP~Hjd*C_(lu /AШ|G_pl!N+dCm$;\ Yη(Iw8a1\u#>:`:-'=lZg  `ѻ00h-:t m ?rz/1UGK6CHX\}VS,9zÍEw"{ёHM=H%@t_A#LQ[zpu/`{ hX4Up%de1\b< Fm\rf {&,? ULy{ hFfF=XTJ|3ID#o{.!CpVB. \.RlAZQ^y \?Udk XEq$*KVr.E Kk.b3Ł<\ՆȚ,id4B솏!pb>Jw'!d- [=鈢TB"S뭐zks#d =_bC\|q~h3QכA,=~!Te"C 27 eŷ =dP ÿtn|Om# jՓ2?F~Z)@ (]'oߖ"WHG2z0>yBi]vUMi Bc ̒]ع Ϙ5HJo/ƃ'N!S"@=#"`hV4,PkJkL`J*+ygD7{詰GLUX(E ;QOm]%~aGL'5~ w $VmK+yhHN&H7P,ʒ8Hb.tnwN1&- Ĭlk E ya(N`z}ؽze>~r6AvtKYΕiCMf 2vTqc/֐P}x}gaE<wh3c<8!ᔙX_zh ~,H:wcdaie xm"&@FF6(ra@5=:Hr7 Cj/#UPNe0_̂^S:q]1@crH@~@="6o"nawe>2 ;1슴*]$7:YIאLf}1I0}&!k_0z+ TwD RyD0]Ǩ/SB;nw)"gz/yKZ|;Z)ma!ޭMsf8 {|wc3p&76.24G iRc)mF.Ђ0:wo6:@>P8c^و~O< 9LAud=PA8gJIg ^Dr)9Cdr^fwZ'Lw ajv.w[ 5'2$LAOƻd!z8M{ #d' 0cnu~w#Ytv M'W "2Jn&<ƟXceary$N'9D/5g5!'xYˈ\V df59"d (8P6-325 lP&yjm{%JBiUhH۬o V5x3SD0ȣm a>Eŵ6Ёx’oK؞}ӃgLb/߰薘UTE4yZѺS#x+әa]&c:9O SbD+ӂ ^G)HSs]#zdHC8^Ʊ6P͘P"ԏ'RRCI hbqQ|"~09s@Qę$)vz5c?R0!oq-g!ĵ:v\zPpGs nq=gVf*:ʊYâV1 4q1~I'ĩ2UX4%bEN~A0gK^Gϗi h bJ2Y`@&8x_ ;H'_wg13ɌڣcX"9PCEgjٹeX?!=6zJ$ڛ`z'Zm[Oִ~Pk!x̯ \ATa0z,r p!6.3>):B[CH(Ȼs l-rcSaLR-G(9Q?dpNy@1Iuq#>ϱڊ飿6@]!:"ppU-5?kr*#~~_ːq7;!>(e ;mBD:Xb/>)G ;jfrHάH_|fҌݼi $ʇ0e@c`"X:Dn"a˒ rg [8!v`^=>XDh5Iʰl$BhSH6n.WFӚr%)uBG5.&Z"Yx}za,ד1GόQWVsr)UEYw92VZf#C&R8TH$K|_F,v^,,8389vK#?ijDAԱF3O0+)M,O?[Fˡ,8XgGj#{ ?[yR5lAzuQP%VAgs2e) ޡF{'yzF+*n`K l'a e\io "f7d=| <_S^\KT!NP\*ؐ=ʗ]89wٌ*q|F|iVKVk~M[%oUV;/,8J9D/ѹL{Hg\|/]Go]qCR2(Ԫϧs:פ$% 3/GPfDoHj-fpFf*Lԭ.obp(uk7p"@ $&o@^ ϼXs;Aw-t-i/vl bȿ "Ԕ,`. KX=? K4_{s+טou;hH™KD0 (u&,Z_X7Ql!A9(DC!T[FB2&ę6Qx950s1 N~')$G7 '#oau\l (/4Yː_m-" .h$4&e+Vjq(GǻJ{o`-C'7L5)<ӶCbSV~Q43_1WؗpZ yb#8~)1K|'+-݄8c!Ǘjg>U||r~Kmq1đ9'Ki:r:1C5YPtHE~+ I@vġqU(ϩlc%i4qy?YW /'KO * Ҍ5u"X)_&>lqo1H0 2Op,lʯT=]/Nf Ǻg{WER^-1'n7ѶBޭ<FU^eJOi\-yEKIp:_jyq9SþkLMOasI@,`]Ə2>fk6`Y E'nK!=,3=Μ0et.B; WTw"0 |`& /J+X͞_# dng[q=n p0@*܊3d~.üP +QVPx(;Q`|j.@wt˚t2Zh[@tTxS3b.^!*5OGf78qZn|V{#&!2E/3'IaENJ}=B$lM`iS LH~8\M.T_ޖ,4e|vHmXDSH٪le]Yĝ*/4AL+dܶyIk;3qU+vD2] +>ͭ|XՆ|Cѧ2dwZHQNVMW&"5_!s+[?5M ӎk(" M+KEe iʅ_*ydI-3vz%A>+NMAW1Rz]5xd-rio} @zIޖ-C?K" 2^xp>HuPv2O'\CWm 1e9‚@RS lp=_[pB̆K5Y%-\ƗaDEhfpkBp9Ɛ=.ɿc0RNݥR 8' `k1 hϛVE/Q0*g))8+u" |H̩+dԾy '»U}&eU!G2H[7F3Gq IvHٖO&8R/i\fxOIiw2)|'VR?ÈO/of-d3?*%Jc%`aQlh~%7ٛ) ah-9Ɣs4,[KԢzVNNEGX[iG|?Qs /xw?rR*G}/ի*Y5S%܊u2bSs^ńKB d'E*޿S)-J_OCJtWu<f4[*)X|(cLޙ^/_u:0WQ%SJ{]L2>P7ֲԒlR62|%0N~+xZv"+J.>tXteg(&fYW )= +<j?=06us<51MP8u="{aѭu[Q"Ac 1@vdܹAϙsh6ISG@"9λdYMd 5)PI7k8"O,C3+9/i?fya4]w;}dm7*t3>~:@wlCN,Q s7 o=rEHpe3lqJFcuXg9ȮeJQd[sHOCc>SPà/oωwZf&JyYUBxqi[Lq䬧F9\?%a5D{R12dI_>K̮ åV<pp\ &d ]2J@5ڰK/ֶ\=.'"*³J23o˜XPzz<BֽKd} qB n w2FetRq?NI0,[ǵ:]TɔoNa\&Gp+.bw,,.;Q@n'߲RC]~9( 6#d7R>l3Tފ}OSnw4ԁ}VTWpp,D[:}{fOǨ2.+Cݽ1Bmxس= 0Oy< (+.%$&/T۔g\EXgS:1>=Բ ~XA/b mbDI8 Qe2#ilRr掀p"1F3| Vya0ck3@3M.&g/P_Ts(Y>GSOj>HZSYHu,8?m&)/.b~s0hZz߄95ZIe0¢w7U/S}d؅ vQqMx:.<0qk#hTa}ڔyͻԊy!%?r<@3>'l'Th8w'<1$A9YuNluIP̛ >TU*a/8矤ۜʶ3?LϲfjJxi=S}/Uvx&:aP/`^>ϻĉœVx< 3OO֓<{oBv6 G3$sq'/ץMvEd!L Slcj).cV6(jOܺ.uF20zn=2-9uA;H#Lstɧzu~VaZ74##WbJ { -7bvP ,̺mE/d4; Z/tm!`N`i#;!⻠WA]fW[q>2_Td =p}kdܒ+.ﲵA|<q!L9 Gdk `!}cutI`mzK!eȶ@6! VPY `Z8@Q` iҖgt? ;"2 33d,Y'6Ld[@` 4kc[0=)M䷴{mMi1ѹOJ_3X7 t j3DwơI{ƞt-%O/2[c@O|W?WAO0醯aJwi5'ץ1ǦqUe[*KMwAչ1la̐\3_~Zס(c,8@ S (iɀ嘌"}s{Pɨ< ɨ!ATE!!zȃTBB&",E<} F>(NP>#NF;D mN/"WI`)!-"`DZt1z]xe4l; @<cF"0vJn&  ȑt<_TrnKXqx>unD㾵5qȱd ;Z>3n+u |xT[ Q z\y΢O]ߦO`Cr b0 ?D(pa;Q)gf@c)lgm4ksi&aKW+&*> -EAd} a>}>Bb<&oi}DӚQjJ4Yrh4G#j8aXxΦ.U tp PT_G&YHkCPؗ" ʣ~/Zc/:?w`]v$/َ 2uSqHMN/-N3FW?ĈʗVіP^r5g=%+#>g^SCr/q̝vg;(Nj2YiQ}4>WPJ}$.< !ą;Dc[ |  ULm^/#㨩FIR-e"ז6F5f_40x[6?K1gA {ޢdGAHhc0'U%E% JM9: Xut]T?M_e,dkAtǹS >6bB>>'= Vþ!B/<JInp+@o-cPXٺ(CҀ$ n=%x7wqL P|>D8u~TSCu&w`=YRGS shЯK{pGP71?Q R{\tVTBy CZȾE" aE 'Bp86˲ۄ돣wh) P=;!qiK_E} eRc$= jM}+@bՇCYC)qQ萵hІJ\x>#Kz3q&B-pX}mЇJz;Qrͨ>!m<)wR_BdG ;a3`~hElgիRƢӺ5LzBBqin׷ rK/$HM+g̰_D?0U7c4~*ܫU|KlR-.+%^*?#ŏ ("\$˾) oh z,"J)mj릾2KAo<Š\R4 =51׳Ba5]V9IB|ЯHYcA=Z:J#2{vdmlH-vM,c/*:Xpţ| AtF9&%cC2>̰ 8]Qp 7" e?Kft}T5?-> =YOdFlIO= W :Lfn`fx50ֻv qэ֢ S&DWxtX5L9L@s#Z g]D]FPp(! `0$"gDp|(u'<[G/̠QG"f.΅u3t[m/5+#£\9Jj! |HT"]Lŏ_Y})ttpW 6Ųxyc/ys#>܍\ZiaBtےva+*t/nSAvRnJrGiD.Kw#krIQb '$8G/Q5,6x[`Vyp^cGכ_3*un njazJb"("Hݳ{r;aQ ;柙733?rBv=F>pu>-_Binih)sg :+Hk8+څcCtOwgEa^ˮtK-DxhYTv睨Bh.(^Wa ׃ :Lo3DpY|ܽU|أāMܹQV -rk9/pU5B(FT;>REd_5>$ٚHdz7 HS>3-(zZn8l](qT>=N6$K2F7=3# 7lnX>ĺ`sL d~îVLg͐eKi,E4o?Nk3vS޼e9_]dPXaXvajNis;o ҐQAL^2%@9vNh [ұpUԅKu U\gm\n?Nxx`>>1BUحcfքhԋKU4A^V̖ޔ,Dy%½Wxܵ6ϳM6 IEKl-Zw#MףrqjLSiR/]Nܗ 9~r öLAOէV>yZvJ|U?/b10y)H\E/L$ih*o*8ڪ}oQUUJ+Q[&]3}ʓu U7O*DߚŊ[Cu%wjܛeX}1/J&:A V7Q$Oהȯz WD/CUWR3iD#q}z?&||zNl{l?h*A7lSQUt)nORUzK,AŊ>c{ P/O>yLbҋeUQqd- ٣!2NJO(e9GNaP^X aݬu)EK 9#~ye,Tˢ(]Ȭ@5y2-֕ $%Ox,Uњ'O{y/R"ED(^gS1gs^gb6(ly;SRg{gk+STZM~L.U.JJODdq9\Mom3,~_L-H?FG3ƐL3ha'j5ōʞ o\%nۅԪ8pea\s`S/^w:X͜W^JPX^k~zڅQIQߌ.-7Vu>$F-k=yfc'f6&AJp1h\]|N˯λD5'yU[# N&!• Oe{ Pm`Z (~tGD`Ckrxc٫U˄1X&*ˆ*ch'yث 'p6-'d#x 7&r*{mliKg+ k2X+ۓtwUsq7C[(-EW91m5ÂeMT|}(J9UghF{!"7^q9.r5}ES1i7qlTiReK{RbE"R(wA^@) 9|AcEi&PeFO0W"iH2QLƩ3&oC)2[jsa@wE+L7Ɨ@uUMb]@b伷F u:=>V8i6έwg״VuwYș͵gl +*#5cnUEN6/qMkn7sȼco 8czf j8^<8xG~~>}TzE\dC0*2>)%k~εN*ldptD=h/ІVD(Y+$T['rwUha`erp6IUIcUTc=Yэr2I*+OCPՀXIu~y`e(TwPyJtJa^(TSxG_V}K.ZObY~KWaiP+Í8I͋}W lJu#1ëϨU}ԉ3yT*H76PA/fR\@GzTFNǏc쥙1{/H6ݷj[1N2^u_Q3f m ÔBf dL;a.u[:q%9=@~<.)de^ Z%w~u)c!<9)%O?H tx:eHY1[&` 2֣ }xx|JX~s̉Эj$e@Kb#H )T"o~lMI zA ,.sxwɚsZ̄#Zܜ@V!B;RAΐVQE$Z78k]'@Y|nOLVu䚦;%FGEu,@}g$ͦ'Ӂ\e_D9Jt!i.\C yP Bji€%~{f̾ zzy?n.k_t,$6/1iy*Ffl sĺl>3F}k*;4\q+٧p {4;8eaKfeu:/d]erYYYC%]n>[ěXv=3(:p>+;P4KZTFb6b-r_"E |e+Dز*,9 |`l|0&O8YσT`.rLkJYG 5Yi:54֥@?%.N '%U.>)ʼ)fl1.qY+˩-+%:c]^JdRоfuKTm`VsۘgASásf38n2LaLthPb<dmEaZGl/{PҦ̹LLFy hRx53{I bVo;: 8/Z&sf8Hk&(U=bD, G㝽BFvU6Bd\::3pf1of^=4w1-Z*o1|dÆߌBeφG7+cO =pXk@yg{y&F%^F(>x_ r.r AǹEqw4mt]/YzT^_a-5r.oc{_Odx z;M78Ѭ!`1jaeF${ Vqۘp74||bCDŽܟw!^{? }q̑ R)Rp./Es~=%:oacW⼕Tl//hp.w:OEf2r|aw ΀Iا'"xۑ%km{*K}:T5yG8JGPS}z!pM|7û;ް9`5"-q~wzLo:YՌ.68"),جS3rE]hgDSC OX6o|N2h(ܢS;ïqLԟ2Bc\.Mj"/f87d&@ƪ KI5}ൿ]i7jb$#|80WM+~"*sյ|ͭXOf$a[Of53bEʶ(`:p2u=>Bdu&)A'$]YsYNafdaY$xd.:^hn):_CGa#␿Ĺ˂Iq9dd%74j\O'8 [zoȑhISC;>#i3a?K 4ӇC c1;`%sm2&{ԆoAĩ,y x%%ͼx c-vs q?60vfpKFʒkŘV6EP iB%eï}$xVm[yH 7ĉ]Ipv8T|1MB0ByTf#^G뚸[$rW.7SRlFX?榕b0;(z{+r}&CGtrKGIŴ֮'np+,E)8K8w֡xޠ x';d:*R뒄֖Bc5ywЀ9zp%|+,;9/_@ӹoYW5ռ3Ut)QjǎKI)p.o"얱2ZywA;*Am5IFwhw ʳ <)ݫMcmt$X"hb9OaJ/$Fm4@BKp϶?߼`]rGQ6K^_L(~ |s] ] /(+^J-ҮϢ?n)+F:D=PZef(JE(alsOTRMj8ga^|ybkfM-A98{k3Ў-al K= )xD7E$"h(zO rGo{q'e4uf,INSM/DYq'GVHcNr/FLRˆ#l'"bhkZVҡVRd5q8 Vn U9{Uzsn7yCQc UfrlPb8E/,+>.xmф"_p{p+naroMUšԢ03qMW3# &HDsP&oVw~Y83,[d}SNnڴ3N=!YoJZD)j=&.-hD ѫI /Y;gޒ`͵֝v W7G!xXx֪}OXQ&-8.SR|XQ CQeb~k]w[D~Y(:6<`&$Wce!d@QiQ'_dA4m%Az\1+YF1YD _ѺQڃq/H'A\(4$ֽLM:F:9+Z_ ?`Ѩ`: %_+dA£EY욍1sOYvXfvAs-a'Vߗ' 4q %"C=Tvaxu. 3}jI jV`AXYJk̻;Yagjl%N4(6j7eii$ӂU )jlZ$KIDݳEay7ŻV6ƛhVņAM\R=P$ߣܚz]2$ ?6~y\>k.)qyFmE[b9_I473(Q\UvE[|;VY&cg|9/\VSk'㔎1FS'>U_xUbUSiv=Bd+YUtuw Ԓ-y/y{4>u#rFŽT1)ba`5tY)A M[OwWPPŔ-Kw䔘ӈ[v>VnMT+6#[B:l O7Կ\}' iv$?]&eg. #eC$~x9 ]VM;^TO*$127p:Ѭcd@wu!7V&r ceϙFhBd/=Y(rS$A%i\^Q|2Dh珼ksU o$'71p֒OEٶ:fOb;R^ȭ`4kwܑqZílĉ袿va,y^0&{v硲p#UA$J2a*qz;X} hFWnPW+aLHeȐ:/;o ʔL u-[EbV4އ\Ra%ܓc{0HPXſB{YʝǮuF_ aTN. lV!}IMz%~Ydw/rptkߢs1 -+bŖE`=9C3R%(NGiGgE מ@҇Zarr~oaųn `^PM0-%W Y<]TT4YU"Z#=qiuk? -d\ )Shiጪw+҂aMRbCGƃxoSv[ȏPR7~iy P7з*O))kfwQ}$5.`]$ϤȢ:.qE ݘ <.v!aJ :턅㖙B:?8,A++bu|+<go;0X"-op0g͕n:׼_jB+vnFx",ApKt<»׌'¯w+5eMmsZdVx~PNzuc/EKnWTq `|YSa| Yma$]-"0Ȝ¡,rϟ ̎'1G ]k/*[+/Arm|oSgbm6"E4z{K`[N\5RO\^$c~N<ӟfMi6W#¡r* _6m.'5b#c1,\;7zҵZ7c*׆;TY61?W^.z GβZboR^eqYDx'PA0%KU>gT~}hwO%}5c?'rߋ [®W\Bӷ<(Gvz'"]U Y󥗠 Cad&mG߱XЕ8Ϗ^sSad-Qw [2Myd#uA}Ƃ\oBA\t[>Y\'g׊1{i6m&~}\:8wV̳yjڄ6OË=]bY\ZiہS P;V}ѧrFәܟuzyj " 4~-j'N)~KB(}\*ޱH}t596,˵^yk̭>,@%E|XN &}1g^?@?2z::QMekpas !8t8.qn^Q89:Ew/nїӝ=O VwXF2p{!BPZݔ!#)*tC=bgGI/L^Y{]{o/0&39qi0DOL@E~ $_A&;FM)OkhoDXΦ+iဌ e G0єlJj۶ZSIrWC]#9}+ 0(u?Wx3OL#NJ㭕YN̤h;P L[M/3wgZΉtx[x,ė u&}],17+~*lP8SВh!=oK+p+dl/ u{=V{ijfY"/VXʎDޗLo inl2S& ȟ$QKh˛ \nEՃɄU:ܡ-Tr\J%ZI4 A+J+h&*>`96jxGk[~u%*J1r?q8DMe%D:r MrhU~_'q!8̸'qр0`u" |4B2Akvy0^> CZ0hsvx̝[ΘY k{ %r|: X|^ǥw*Btox9˅sSxgl΂STdt'yƕU%:7Ǝ^,uҩ-t8w^ Mh=`s0GNҌ}δ15Oi nnRfCzI('~L|uѬ#(mgc}WTT@[k̴e?92*wRӚT3yư(F_0:|$6SEmkT}6)D}]ӁuR3˧R>P_UYbݟ4[ ;@[G_ú|h˫h;UǨjR@̪6}g^hg}ˁZС}ww{+':_[.x>+Y]F d7!s{_HosS93t%ֶ5.$a%"QȍWj&r! Q Y!b&<B/gt0Gas~h(rq/Go({YjƳ= ȋi^b-1ߙFBw>(dؚ -Ʀ@x~汑 "x2Y+\| v[>C~q!ӠW2*΃u&N#EN88K90 ޠ04}N-KCg23ۄ7,`k1Bށ*V'V0ϚupkD4 PȞ `=S^Y=<tY``~x>?A1^ =6'e`鄒fԤ}ڢ+)~0K-Ů!Nt  爃;Dt_` k4\dV/,Y X,WK Q|J,S&1ʂ)"a`n=;5`Okdc5J)xZ*(jc#F3ӵbLrG$f{"ʎn:{CO/foV`\]py+!";7Pñwffu& {UlnʼIk둰rlWDg 6p>(&ZI/-Ĺ!x>$BYZp OW ES,O-HC<&9h .>:a YyѾBQz+fXɄJ8bXzy@+H s S }( z#}33[pcK~;ӝE6?n 0qo XL,tݙ.c{^G~{,|x+e5U2x$6ΙY؟{FKv\G yrcx5t^[ּ:鋊 F [RûԎD ʁwvIpTYPa)=X~})U cb,|[GdCRW*$dv0 >xQP.do7?7sPxiâT'v? _yHfZO 2_RRK l(!.pU+;dNM]Uԯ!.I M6L%zoAl(qH3w- Uz*gȝ;@ 2Mt('4r2٦ق:Zh3zB6#2<SSUЭeC|$D(7>!iH[jm4u\*D=V1BaE1g+GWf5C?6'c^M; zs*^,ܨ0}2ڔYqq 7P,Dr>q͡-byȽfh\ ӥ je.=H;)v܉rAMAi:Ye+6[E;  ~$qvTh5lIMJsm"~Tzۉ0` eono<72e7Vi?'APRT W)ZD҂d|1AE;^ۅ]h*847婇iD.סX.}.+#8lA{DB,lAC 0-7 ZS3D4uE.F:uU>9*JW 7f^ dցSg&A3ZgFRn0D;jR>Kgcf'/U HS<D6#O,c^hb壎^8e~)6RKڵk_ZU|.KdSۭjr"ZsMlYְ6M4T|K3~aB%J4*UuêL"%:wl2(n4l@23@g?+-3)w4?څj}Fofu?kYoS79끭DKm_+Ji+kʹ^K )u,ի ,$\XGԼiĠu[vW5 ^|F4a7}Ph:GM)2*E)X!r3^-@4 W$)ZRGG h\v..VAWA*l2*, {կ%ysw(53sj$5$ vWTaVH?cLb1ry?dzu!5_fj/CgOeYZIjR!^)Bx{8;`FzT2ᢝ;ݖGG&;gqX%ɚ'A5EJ]=\(~,ݙݸDT'՛Dk6k1ÍsۯADmxPIT0"Țdiſ<k75T{hjIFc~a.X!Vmԕ'PTF^MVš=h}8V*r>Rza t6*HÌ j[fW{%WnmdCuiAX^1 /rre=kjktNBV4>oA=LIQStqѴ!5@i?ZQ~a-br Aa6|v/Ty:!Ȍ;j:U'W帺MdYQILe1 //oݛVk-笍nrAna|qкQ6:xFX07fV/ xҢ,kxN =SZ޹NYTc7 YD'azhD*>Et99̅Zc:,N9.ry$a|!/?[ZF16f֮lAT$ȉ%`9hڊ?kHUф6T̏l)w٭rt[ͪSMcDbZ>wի ߫qM.s0B*<6M?9DBnn,Ϭ!,xbclxd]r.1Qiq|ETK`Y^ OHN-!&z|l/%O,O+gztumUjk/i'Jޓ1+ ]g0YyFKjQfI5/ ;,5ۣ *砉L ]!['$ R.{;>TR8[Vyd{N\uhN 2I5M1m7{)m)FʞהDΡK ْԭiNi]F?ɐU34/:z+Ɍ{3wdF]=?9Yk7` ke`lwlĝXx0:wm$܆pE1z;܀MM܂f>^Pg‹qШ~/NqaA  O*٧ft'zCo -C~?{#ne sR:<&I\>h'Uxo1#+v3sZ6Cml\WoE"UZx4H-M{'fv>9oy*\iX* s~& r׍F:)o΄_2u$)+-Rvn^ײTr:^#v\Ac"[dd:j[~qn-T綺:+]Ќȁ?L`+f\#N 1Ka-2i 4ѳ\0kuuM?cWL!dTaB'䘸`,۶60+zح,Zخ5%j2k1jwÎYN(qxUOBqs>l͡$2alʜJˮcԸGh4RYJ&0( *36x R 潨VVvo1"uݡ*|GI 1u)>ԇFa k.~S>]1Cg0РtjZ!(PwpyՍR-u+2.#X=~_+eh+XSfi/# Me8xm<}GJ,۫,?/,Ѵ!<ʤ͏W kPG諥hR*7rbF^yPqurU;/(v^SJ<{7\ܕV^1^IڜXo'N%5./SuImb_3lG+KznWɨJoԏCU4vF+'7WT)vx$62ן8K9z ,( ww }[7FCXAWIQu3rRhWhkC9r~w[4l*IӃ•+,fq1{L^挦/s\@N?aVGFٕ/_@ '2.3/1kPV1:2鬵ۜ89y?փgx4J@R!q{R=,㋘H,w &D4poy \9Rc s#1f#qMb`QK8mD N ܀Wyg.}r=)X"2qBE#E"Mĸ[Ȋ8h>w瓳=]j7<6]~ i_dߒO|Ǟ%$s2=cID] $%>ڒ)4I&nn>WEՉY$42gЋ)FW4@<`!uԞɧmW(7w"Cp֬(`d+{_Mb/W呇UCxJ1s.ɭEC^"HTC-+ i.}!f4w#wʓ[h$%t! 6%ĻyA J޲$dw͆4&5x;H>6K8r`uGq %ɣ{I625a)&<;k.{~ b+Up!ዃbdyж>BG*%Htx:X"%P%dtFJ(^͹qp$w%im*o hŖPzD z3^'".y2g =+s"üh@蹅o9XL*@Q8:5 ]`*.]kwA9XV#=By46y38Z™H99Q^n✅T7>pOQ ~g0o+iQT w,oE*sA"~//_IpQ)>Y NCzT[{8ߚ~.UtyBNڨX`}93'HΖna98Fჸŀvb=v`~wA_/Gf0CYWu3m(H.|F[dQ7"4!F`U{.b ݏw[ç؜KQ0v]8Zt9*%xN c^q3ܣAw2= O/}_@WyJ=C0ߙ:-{~3.@1ѱZZ`>t?:%&km[yRa=OCDR[},!iOx'f4 9A40@͛f= v+d{#&xGb!=żB0D!o Ǯy[/hPa3\?BDdss0?`}ccTI]z鹔:0Xf$% .پ\fYtnMdq]\i;_K](S\T%iZ zա{p5c-L[TuMu6w8мh yOG[T$w@vLSVT9j-s:Py ̪~We ]}c۹z7N0F:y+ohǝ8-^ z}S0j>&$h I{V)~kDK")h/Vj<'^B.Y'Tp 5Umya24!z%~ƃT#V ^+ea8fDpgB†N1#4|M8-ᮜIy!wzm {5=rD~s߹DB-~p.$]!YAl3vNxZy`i C 994 PH OǓk:pQ,aXڊ>"`ўu_jD̆][ښ%yYvU6R0͖ W(h+\ ïdVk֫T7!!i/hPஹSzܡN*?(W&0CTyvTG(&-$( IE:ZsQOɗ?bNw9N-& $G*Q&_ɍ4/YmnP̺*a ,,a=q,b} a.3*kGdw |(V55HC0{WNIT7>}O qAR%VGW71۷WX%\ypE0 fjM(S^&/}W&>}+9'H^$#&^h;Ag>dE.hڑ()Q7*e=rpՇҵ2L&Y/{ *܈'BEقtGGt iWj4NDe$2A=)gJ1HӅ? x4,49"=Xfu>{P2M>PEp({U{m"!S=" S$`νMqGm+%C (UMi9\/)lN7$JU<@H/"x|\=P*8\; dRxB\]_ #{y*wZ*e@t>K.OGTj$4NXkdQ}7hĽK]-^+iED ty,fF* H(7O~vR\ /*=%T/y,u@V먒#=rpoY+ +%M"oG!+~Dng"Tk t(.mSgw* n]Qnus0m9!k7#&1y0I/'jZ)O /ŷ%~τ"QL })6X&4/L(ˁkFU.WU=VQ/=\!NuN8}м^yyQXňa(^mE|h1.n@E:.Fr%ByO$W$J \W8%/_k3A[]yN'u4O;r4nr W/b+ZG]<"y ujR|' $EX-nB=X~|K;+7攡]]'_~$ ges%?XtSu-ař6*>}!A}3Lu@M5 ܻ,%Kˁ۔=9&ʥ.kRXc!oko/ ȃ.m9ȴCm ÚQKk7'YB||_WXc3P|e~2NJ{"K{j%7¢kzQ*2E$õ]} ^WZ.y oL=3$:Z~;\Q5SW+̧1Xs^^/߄ZN\TOVuvʕ?iZdvm Iat(Xb"uny`A0zӒ!c}yeߺnhoҾ6Sq?'>F-퓺g+}m-BI; eKo+}RS~ޱY㛮iHumJzL[;dC׬ 8 %§,+Vwh%^.TnB[190PV!ad}~+s2Nr{"chd:`f~yC8.G= P9 Mt~rs;Is r\7ˌl ʹmTdi~y !n9 h;3b{^RO%YL0KE6ލ_ά@nJr'&\7LJwnCE) {'UvPXWSJBtA{%t [wV&}7X}?OL,\ }Xz۵T YT!g)L;>{Ur)yµIhqe#nG_Tjv(1 hmwʨ:DH3tSy8IViQ:.q#[\]HDcN t}5|mpYt?Bn&cUc2pK0趼;+ 3[?w.l<.X?Vr RKV>ѽARk&,*?ݭYy~No=uL.ǖoUTGyZYR}T垚8#v{#Ppq+^[2qssijK_~QX=3[EegQlڗA=d&vZDUڿYE{Y~ENȑ=e Tg2󈭕ZVmM?G2x}9%m2툥xVwRc4 UGϣn~da.?êcJ9yA}4jCrKe#Ӻ f[#/ K#8ꘃ@zM .M9o[IZiȎSB=S>cq K\˪C;8zen&aRcB1 o3' (1dEك[悊7aD$0!WB')nk[$\bN&$sC!TgagZ#Bl3VvtِLV14(xHM(^&mF#Ju0h"M?<σ)žI.VkX~Ф!dXK*.D;f )Z,HSr7DRoq/AAYoL gl)5yyUƟ<*[26-_bVAT-ֱW}_w. ^pF[?-6-*M8kBi)QG}; Lc%9Ov-FJՎ#ߛ&EUZyig-\A0N\A-0E87Eswc+o)Oyq.W\ľM@K\Qj%;dT*?O`QdWem$V4PY-'l|ÙCyXϡ攆pN+S㧁#Y<60@4Fv-"s}fVr²XwXt:6ۥd;}hC s"7 2Z< AxX+NPx^:K@It^xIͫ ej$wGRn4c!X em|X:/P? jjvҬCZF :D}*tLSsdu QP%Bqxy@{ TH6CIK0PWN,F3~<`-AC8gN\od'Rzm@NYSQU t&StS"hdZ)IQI~z(l L  emG2l|"?C9a@y?tfl{TŸdˢYz;}_O$5^m㓺YO+k[e/XuIJ:Nm/./Sʍkv2NY&*qfW:ms֕-|.@bBr1{Vf א$23q ߹x|8UTҚ6 L{=PLέKATGP?~7L:$D +{K6%',&-{.cAed)\IO! 'Z'ѓ`g[żʡ+SՠF'}3>J:-H5@Θ9!k \p4=MgFdl$;П%* FץmsĘyF-0w ˺3F i$40O8 .~(H&WR/q_bbAoA^) yNmb_@8n-C.*ᰑW2s ,G ΁uQwE\Ub>5(9^O`;K < p&Z3UXF7bOVozs\^GGA:-+AcPz0J$AbvGN:[$\wM_ `.8ne/`<6}Ȕ_f3{ /,/3zN3:3t|.-+hD#:Uu95R-a/Ȭ6C̟1MrVULÑKVy m0cJ]4G`̩5uL;K^y9bT[df{^Fp9GVf;]mCmq5Wg40v,ThlejJʇ3YmZelJgvFxp|VN&Iǁ.uIxRI`XULa 7NKIC"h}V0CW4 r DZ?TX >$Y(J^vB]) uF\g}Mp Fvt[V?z֭Ao҉h򔱚șe2y+{HZi5 p p4ґ?(Nb8xDøS<܆l&$8?q5_fC`J7v#Wަa~s((?̅p,tl ;3 JC[ #"U("g+rUp `Xs|#87 A=|CNP.3y2&/\K1_ys~pغ"HkGia/Zpi 畼Zo~ oءÃ䑼a-E@d?T D^#xIN.D[;ckA0ԁ>7gQ"Wff)gޒ S%R7]Ѩ=810LG>Z_/瀗ZF(!AқOu?:Aֻbn\ݵ}!02N&nL33y$}l\ee_+RIg%%IqVp[U є%rsH91U.(du:Mrp$j+pI$ %(L@_Jˈ_,Z-`0>' '2ܵlRN?KjW#40MD/*(̿1n Xޱ:(;#1Fb'qU5z6+Ɲ8mBWαJ^OҺܢ5USh-MDj6iȉ?E5NX/D+*SMhL+Э|t;`+?!(8B MC˘/ +V$&XCayzfV@OŨ  IoitxA.(l6I3d ^1!Z< .zO QLΐhrP26D3^|eu9%ߗ; >#dAMTNr <QX>JdD^MF_L从[ 9IJ"QN.;KSSA2nq}j{ =WDρ.e…a^DAAJ$caޙٝٚ]A@lkw{m}yyAGi#7m?3C7EEHw_1!+'vy_eI$OevɂtTiZo*X*sPX3u h:n_-VlQd.͕D&hzG2<֎`,ñD$yf* ~nA&m&u٢D4 7.`ę`(ֵҡ:/NvNƃ7d9.o(Ra@IR%ӄgLlNuw縋 |j4~c!쓪oAU #|@)N3Dn Wͳkh&ðN|Ӿ/~WKhRža7Fx?Ñ׵䓡#T ub5i!b]1Nr4:l,vu۫Η?GUTь)-Cr5M9qa!aƄE)vK~#]%.EפI)5ԿUkg([dJwܔUi͊aK~e]dҟ:dÜuSD5zp&G U+qfq7l>brE{gU*]JWz*i77 %TXzjK4uj*7/֫Jb\z> t-)YHŭ뫂Ve\<#3]а)?\]t2YoTqI\u }ڲ%AcrzEWq+*f/{vZBgKiJ+U\HxWKZu z)%QQIiǍ_ %/~]V¯mAN^1H{iQb4vy%sU{ū 7.^$ºiH-Q|]v4( 3Jr_6I7ҤJ1VD`@Qr߻gIV;%y{T˸fPib0޹Xlq")F nxĚeUҝ8m mM O]CPR[SZ *YurL 3}v*k\Secl?bSTN Ibxk<_rPUineTuX#&H9\%Ns8rB~^,eCtѲA~ozT?4V4IQ)*ZXl TWxUޠpmk.[[?M/[ Z _WhOԽ PkV+' 1?D]_=BpCt' =z|keWK;Z[k"rPiR^xo*ul ="d4?fT7f0ef$zG¦]A4C?0Q |Z'uY:-[8b#Sal oN[6Qk vE1*&ш&;40. _ V7뀄t`wL&MBS10U'[}>-:6R4X3uq؈ַ JZMxo&=&#ue:e(*u[0m'o~Sveg2ML>Ūx |WBDkT*b>]b?Sƙ2)#%zZ~%Sۜ1ء`PG 1ΪPg Ul$hٸ/EQOWqpNp%qFi>W?RRꔘ|Zd~o.k~ýhhw&مy1CPD@_񷚨Mx\y E7"ާۄO c?S׍d)]JϾڡ&GKc73KCR~l Sm4| >-Nq ? ԴUdZB1~)Yټj[Wo~,8vP E:i{DY+YΌ}wcj`#;;89`[4u쮋)R_t;_.triUGGvL-ji,^R'5И׶WPPHe0,qR) {Ź]T6@q[/kK̪j9%}DkXé!_[ 6J@"Zң i^ѤWѨk5EjD'&k?yg#~24WjSk9G\SDІuIZTr,jclR{ $e7VI!k)mf4ձ@yY/fOڗzkj W,I"{c2V $p@7JP[)R>J;smf²뷪Ie6^&snh}V\s/S'˛ְ/w/&Fv\P f]a@bxZ?SWg}s״N2NB&/qߣ8䋯WuhucZ3 ?Z2֙K=iRm{nz}?T3N_hj?=5M^լ*_&_5 uFo*{F_>5szC<%LB ^?IdM(=Am[>=#yc1«[9A Z=>^t q87)U5 $蒎չ}؝9]q^w}^F;[ׂw]Nu45}XZWʷ\ TčoĆ`N75h!Kh dho8l֖k֯S'ݢ8kGyYb*4ƒlנ9x>Jܻfj'YD #xOwD)#uxk=4zX\u!Ob5cd`lE&J9ԮҔж}Ҥ3M$psPWo u(^SǑt_JNNMF^<[ԵsO)hX{)Nשe ALpMFvh~px+еՄ[4O[W49Pg`@khyP(TstiSxg)&Ϸ t5@h#PJXeS9!Ï^ ' KGkk§V;aau#ܩi| Ç\X\)ތ(3<8+& X!B䃑ŭ[>@^QT$ۯ:JΑ@tb)Z:8w yR@%/%E(;H\v* G?Qiخب z9O2˶͛+XI=? - OkLbǒO Mf!-L]{U%Z ˷6}]H=՝7f)LjRE^5Q+{Mek(Dl/v= =rhhwEf;QIO"s TfD*ڬa.ìA8pqO "g΁W!~Xg%O]0/KdT)zlKT-b$p?T%nR#ל^ x%,mr'ֲʰ)+U9h$ (]A;dn[V'X8k 3ͽn6S\ t1Ԝ12yg`U">aA[5ִ5X[Hx]gЩ,vȩث;]}^!LU1-UW_ֲZ( uhǫ 7ӡ@Cr+ ?KA\wU}DWA^rsvvUT:֖E7 " ]Z79(V|j5 ͯht=kudk;5٦YsŴ>;Sw'6Q!n?-قVb! FI`&%] ~1 tP.Kã#ڑ#*|9d>:ϋӜ;O?1baPǮ$\ qɧEgNpӦl:υsõ=x</深 8${Nxᘈ>Q(B& *fyF}Vhn"R^Ip_ؒ AG !oZq{~ɱg8o H-b/E$9ˑTTnKHgR,$ |E$CRev'Ϫ|1*o'0DX(Tpo(w˽u_PlCli˚ƭ]Yu^+ Usn0U c լ+cϰUa5%(c'uZ<Ngv3LDz4kH|ᅪ$ĨҀoOpB8LoxAmcM5ĉ`*mk]y+{{V+a*\0`jPv| e7(]`/[{z탎 :0z/Vq%T渦Qou:Y_b, )G*F_hy7V(zb gNmKG~Cs,FXcd{AJ&z#ॾбZm[p:^ObDŽ7 D]"zQvy_mH|HC|%,^Vl ;6BQ3aejL @KQ}TX Ipa Be.L^Se2w w^$D`I(~8"?=1ly(j\נeZ?.8dh~;l'h;*?"|B hw;?MܷW2Ѽ׊ŵ ]@^m{.tM UKaxt| ~xcn3 l%iNr{Ť#G}̡BdHػu:ɬ׶I 8L/q MH^!׹/4K26'c[ʥKb^M~&+s3[иUw3 ܲKg=z^)?~QGo jԻA"6Cϼ{Z.-M$6X/9'qڦ}6 ]%-KugXɴYz%klE'r}]YR[m;K9 c솶kn{Dldl2A'oVIאՀRG꣢ÒՌqNJwr VT=OLYb DiCP#$d6I8R [2%-Zd`p^IT|QJzJ\1۪X.>¹*>ǛPkK Wq~^v =yߑd +mZgQIY9i`@+u B4(G!Ƴ=& mE67S. uVlZB򧀷7}h=}ǬuOU ce!r[AV۟!dx9ph7]wg?b5+,:PUCu*GԴ 0@u奘)Ș_Af\yn`5Oi"k$/]c kNn#Y&|)?)on qC[ٙ)޳7+Hib8A״⥬)iL";e@L!'-5`$\"*BVvUx/LH]R &7IYhΰ'y+ɧ$ $Hzu=r"y$yJGnp$|VY}(=n$64]P%O#t>dd;C*kLQũ\ЧyKt:GzI.h>U<ԋ (x|_\/Ȁ:\6_n0% 9.=O,!Wi J CT߳?#gqaYL¢|ħ;hl![lǟ[7QQoӮY\LFHQr͓bS/ Vfw`4axE.h 6ӪcʢSP"a\BX1,Y2TtlY/h_ OAa#,pzG8к={.nvJH<Hxj -|i~UbxH5Qh& BnXyGM3ިӔYVe9wH璀}CM3ħuϡrtJ#B%(qc"NГfF 0r#BԈޅ[ӕ1{{HSGr֮|d|,n>L34k~9\Ej.~Ӏ{j !U <`(c96*#) C(a~Ϣ9U"dj2UT@_1*lс8oSW~ +C`߽XS 1ʕ8If)% _!YKcW%jk#,I`F|dI+Kɨ5?eUh;z/S2Y(g`#l.XS &ȩ鸌+M-Y*=(D%e<cW5v? Ga(jwz Jrҫx\)^B:Y'9&{(",B͜λ4AEND6T $6H"L!wIKOWXb-]&[^śJՆhe o_*7?">eDPtbŭϐ]ؔ*lEAZc}z2ݺ-oKs$ÖEJF_//kʵ$. ~r Zc%W N\̻ɵ9$*=y}gb.٦Nv:OV S+u~Ddu֢-b#̥,)0w?cB4N69U-y7yTZm;NN[Is#1ʴud[6y&4ʪn4/IU}'*1?8GT.X9ռ̵Q5# j@[!h[NpNZ 3s-i(vq^NB{+$gV'UpJ|%ۂGq^0irP V>q>oЊ2t%7:pvW6'@"Q4(h16{i{Ӻ PZvuxTu .8\e w.(kZ"GUy.Ec|g|~X-lGK0Ҡdk-gFr"ZO 34ˬ^L|i iĞWE%j"T3箪";M~IL0q+ޢm7: Q rZ_GԎml%YP#}Rr.i>M)C#`n-ƣRHp !V Db}nJ_[i[L0/܏8a44V <ؠ>:Wň&5ų[sΓ6rw,WMqz1&,YZV5</#[ԾK/~{.9xkDr8hIttUE;]NQ!Y bB11UfӲy>=ƽCmaV k#bi/t*rAhɲ'zpXGn7 b.r5Go1@> zrV@P^7;F Jo4  md@0jNK?$(-{IҒz:B],zB&^xUyQz-''$s++iq蹄BKT58-YbխC;5.zqrd2I|Ma+ҸWjZg#zGkJ/y_SI4*8 I-i6Wnj_7Lٕz:''L4qo tM }[=Kڭ4Ӱ.jxK[iaxe BK,)j~%5_ :o//eՋ8)ʲQoD=ؔSgFèx]Zlf;☼fźriy7V"&~Q{*zGwJwݴ{LFg1a~a"BN_쿁 G~g.S:~8N y8=`*ѳr?Ź7P`Qs{JGy>sR̺e U1[ܐwmr3 GtDIO1곰glU j6iӡJC>KSܭ\xks_Ex];o $\FDo EmOBgqǹ]'/,ؠ@4W3ezzgDFOiG.H-u$&XqҌqTI>T}蹇,s-!XU-ȩ.% [e;<^kdrg:T됨<$z*|/kOL?ѬTJ(aۈXLDE^U ܃TڈQ!(1|.R_(R%,}`vVE]t`hu@&{㳪nƙͱ&q r,6u O_Lb9b0(}LXRi/нctL'YO*|IP5_NVCHsh¸B70G@~+b֎ltp2.WBǚ$2jwTG˕&F:7Ef^2۷/)\xXZs- 6+obbiP @*_sS>-۞|.+̽&̕ʷ\j2T3i-## *hIR $wg wJb~DPyIC,RwouwQkKm,вJS8gA^U}KOQSv1'""˰;;W6lmq.ij_\>^)Og˫Hf[=j|+W<4y{WWqՒEY2^ aT?{^[G (MӖgs }>+ʹS< [*,Pd&!H!X×ZG)أ|L,\*[ª5,s}2*L<&9Es#z|o  *$ _ ZfRI*M8COX%Lj {MN7&d%\%Qϰ_܅>m^4a OoN|pwv~͇K7$\'#V.4:p8W( GeMO:E"$dax܆-ȹU Ԇb\ ρ)L8.-啰'$M +|AОت:x!lZIlUf\OOIs!r6txVK^+cwV!hU[ktDMS1|';*${eFMv~幆v;t_k4}HmIYPng6'QelܚKt-{a_vWkbh^ JyKn2H`mE to-/xPcӻ?U;pwu װb(eA Kpe1 ]jvr౲;Zё~QĞUAYǽUt4FL&*r^3T]]P OoūK1b8 ,N ڼ DِN kęIdyS4L60ytjE;;եDFi4 w'LnxWCߨ"ͫ,`=yEI1Դ@å#r8뷦'۪:& Y^7W۫w5<~6MCoG Oȝvura`b!څ'4bO-m\UR Ht']$m [2jdݑb2}z,Zn:s`zg(F(s]͒QC[P?)k^ڌJ.6 Qa O jn&|o#2ujh+0>B\H 22&NWx:hX5 GsЦm 7k1sFV$G/'^s>.Ve;!0 j*X܅v3O9ɇ(QGkfhZ ~(}EF"C2 ‰w"'[x_t wۑta/Ӏd!Gk@\<>[ny@딿"H lcu>Y[b3Uy?6?yxx&9,x~J>:q59hkvJ푢 H]RB1JTNz ϴym굊mͼ') ԨB>H>p쁖 l N #s&6D^Lck xRx?qmd {$lc8yA\^ϢT@Ck|P/R@pT%26Ӄ--? Ueta`M TD5yP,N%,wG!W"؎4y`exKͫGKy$30z2D֗|tK p1z2yTn hC4?(CE&]WbwQ-w v`ijlP$X(OHD.M EcፒlTWN眫Z#WN5^9o[q4A J|{\ lrc"mMV,7[žXkqTU&/DZ5kP[|6 >T_ċCGz!Oj/]S$ y\!&X)<*+-}v-H^#%bET#VR,WW>)Ǭ 3B%* BcF<^zX7AQ%r [9PzK;*/p7-f+\ e|@sD߀*0Cy:@O؂E~VǶ H-Q7a]"Ex 0%{ f2α| Pc'8ԝ~ Ajh] ⯨Ox6vsf~PgRȋa1v9|T镻S\6lS.WbO Q08ɤFnt)E4c1zY(<(K|dABK,TKb d >ȲuDlWW6:**`vaej~7BӴF莹jQB P ]B!ٶF ilCQaFX2+HC“,աXߛHL6ުΐl j'SׅՓyU`72CF"%4_[. ^HQ@iuMmA y,(Wב(S2"{P:A l4Vb&6K&0R?bvW_2Jp}겫T 4jjϔ iriet  4 w@^1ɺ PO0M$\~Xlv5RsVtq;1bG`\HK(`FgT\2 F#JҳY:/txվ~ 1*xUCJZ?V|pCɮ_чְ:(i>8D_>.F R\7Y4Cʺϰ ӾJ#307RaKwc:8"{XVcIEac~Cʪҽq'O%.O-rYY"zz°#=7G.Wq@Qb`ӭkRB1BPԳ5.5 F+ }QTR%3:>UU5-(?+m[e2lʼnG$y/̄waD)1wW[}T˟WS 6ܤ3r0>M>ru$<అ%aPp6%_K9+o*5)"e^ ~iB1H4'+3=?IhFؕGDڙn!HltSr,kWI MA-g\S^hMC;%o![LS"R54OEtI.pk]7ȮE Sl n{-ҫ{1(g״/Hْ/Ҙ/H]kϐugXo4ϰ`R+Ѯ\g޿%Zզ͢519 S% !m'ZJqL5n>A]swTO_Jz5%Ƭ\mV,/TB7Ĝm\f֙,~G@KB [ɣ2MjEercrCl}jds u6?Z[LLC:ƺ xJ[`IYf&61l)"P^j2 eTPmHf~AXSFGs5}}L[>"5!OZ6#%HӨ f:?@IlߵcZiBnkfA?tڏ YeeJpK~iC+SaB$-L,BRM.`gd s:z7}Cky1edRYS9>jf}dV1qZԍ5qɂ>.$`@>ס 3ui0סug7hĒ(WT_kdW/KL~s9"+3Y/8H[Y;7öKCNWG=V^wSJӒA>o 8x׆Sm+eƣYNJe99S{^dTAf{-⟁M2/'.mUwS'GqWD, %K+ljM=KW7O t:hߣrqi hXݽoEbҺu%S%ڬ䈎ɱZ mDdc90$0눭tkiR0!U?䡤ObqBV@'Wy y^[;vIZ?٠$E39dU?XPDvtFevȠNXJSZ:05fYVO\H:k-߇lkoB8ɃZܑ7|Gn _<_h]ޘ[ MhJcr܍x&^\gd$o _/p=:Hf*6C{i(DU˗ZHw6kcڒ$hnkw"lK,]^F?=;xҏ5_U?;Gjԟa ۆ dѻGy`A+ay'B*bMoNꡀbkruccZ mw/:C2quw>gr %JʞRKǀ-ʭ\ e  ~RRVJFK? 0Ŵ]@V*JT7 M+Rq}n4?/h3?}V74/f<τ(JA\iB*H|chk ƬCG( 0zՃuIYG\-r룅;HR-^Og`_:+aL[?b,QfCJU'e\JJK8-> 9_(6 })Z~ڌ׫wASj^ ׽֛(o؟c&O@ I0a <5._2Uٯy,AfkMEE G>Vex)wxscA|HLPU>רµ(Mci[:/QI\XA0HIdɫde6>k\({jޜӌ XpDyTII_x.9J9"UjfIzPH4C2%*Vs+kYQ(Qu,OZEET2EeIlk׍buIPr5 m"&I*aFzVƒ#mc?5Џ]M_vD&7?cmQ#{{pQ62$+M3}gt^d-o]~/՞Zfa<FޚP=Y0%|q#ҩJH7}t&(U?S^Y1)3K/|R//Χ( &,P-ל{3_j?vٞg2ƠXu/DVޕ^zsRLqR*?"o][f}JY`(ieW|HVO ]*j }CEmL$ΦJL)iryő9Uqr>x4"g4=R~kѳTf,ib]D[9 /̕Ӆ{勶H"璖ʞh"f*q$-e4ۼh꧷j9LW$b -q|R]C6!¢ MRh{p;z6S[κ V.YG$WDQ I _`k˻?ixql{zh} 3)f* d5i<0"繰Wȕ/O|`7:VLnDk4ac& -a,c+w؃ܳ9dĄhCW;9 ٝeU]ָw3LO7[f[c6ϙ> {ψ*7l8A6/[{uLrSuOϚK{8/nTN&V[&0ɽA~F$cRFNQ,+ %POuPo{"92*jOE_ JYrggnE**eQ]`Yt⡷ vX׏z/uպc] &z"t]8t$f>"eZ!0~XpMYQwƔV4xa^W}`_Y[Awz*|> v)Nzz"Tʤ>8]M\Vg2%@c-SHNCdb67(/Ӽֱ«,"Z/4&K>h˥6Xr,DԊYMQ3 !6VQ3KhhibMY,M_~fSnGQσ>oq^^j53?1]A8 &$ZxݖXvRU(3tqA=`|my7Hx׍< ]Xd(+WW8Kjtּ bW6," j07Q=z={}S~s?۫k=5:^xOͦRIJjRuUu>&/+n켍Mdc}iB: AQrroU~[Wt9:2^I.V~xK/ZU{)ɰܐaV l:C HOdkURSFמ- `rõ8UI}Q~6L6u;FQb:XV״1ro/3RcCe (v>$OvBNҮ. E7)xn;*o&h"1N*^Eĵj˒կEi>IJMXV)LlꞯJ4U?w" dԃJCѲ3 VRfR9x*6%.Psp_(-VP*dIgWV,:;< V$BNLNq<Ϫj|7IU7?kJJ! W5iI+{ӑSp|@&$ "a.@Ȟjwɷk ZieV[xLpqksԷ2OC@iW߲Ӻ rCq}HoHT*񐈩1H@z!~Mӆ2"8[b\ҙflyLDcbDП-TԯMFW?CcO̬勖7ŏdbWj QZh bCs,ӟ iMc!r;oMn#'z*)mJ-ibe4̑QD&+(wW BME#է ݵ*&֢˯Y($3🜘Bb:HĈ. e\I7]u9ZR\"Fԍ:Z1m#q*hœ4l`\\3,+*B"+>KE}8by G4:z{`JHEcķпe#C0\+r í &C*ߎ| @~ W}A>/16܌dxxLr7Un]hZ5Q1͟&#I!x\y\8N3f"=Rf4 A'e m1BW/Y:ES^S7?j]\4#B?/5ߐ|[ZԂaoϭASl ;OG#O܃o *)5#;1k؋|mK mqL5|_Lp{l`/+tv~gA~bB:.!+7{7⋩%Y@}){pVsAdM/0W,:j0ҞӍNPWH[盩YA`O;xR k7]cÀ)fp%c&ۅEd՞vJ%,97?U4Ґt]izKF% GXU1Xo1۔7郲eG"&-&]q*{\_%IS7Ӫ@W*\3kN;! /l~Ƕ+>bT{Vu$=nL>*(ڭN^Tډkxa,xX^V@_ORomyk4Wc,4Qm$zEնW&hO"GturXL֞C۹/OAԻZQI@f@x4B;=ZW{uhϊI%"'5 ٤IC *X̬ɈaL"54\رscXR}*FYNp md)k3ú$_ȉp;p I^}|c G/ətܪK:6`}Ȣwd 73Ooޟd" nW^ΈU7V?oP~PBVw3mu9qwa'~6S苻øIfPpKvdY:.}!Kis^!|qTwxMw?nh[8JQuȢWi!~NS5k$%-&5%~q)Od(N3v,B8+t{:ۺ?$mq[ 'e0/C"o~){ڽ'> dKГl]*5%EMlil_A]+ԏ>yHp1Hs=̕5҆W7*N3ʮՆjUh5l &nBVR< "4% `뉉K=n6Ac#'P_N ڸzBIK_jnu0 WW~ǥH 5&#èj!yPԯg 7;D r:_Aބ}vb;EOڬe dbu!(3 ik ){TL`]'2~>,Bqǰ40SGݱǰy:P-z`9E3 `Ǻ2cl;*l}< -s7>ޔ 2n T=ߡpR?wNF',e "xI?>e'{CV蛫e:Oi*t!;U_jKǵe xS/G? jUy_lZB~a)0UU}m}Woզ yHSTTl+y=`ɏdkpCRi)Q5x>G8& /&$wF &S6`tK j "KϩevT %Y3 ͠b SP} v3Sk5 %۫F5ˆW:F>N"7ws?ҤQɂ0pg?׫4%U@w1~,gZfnR"Q^}L{>Ms͍ [_ׅ#`͇CjueG}ƻԞYc5SMf_f#ggn}{>FgD ӍA_B ўYm L}SmdK;ڟJ1ah~|QN 6xj=@h[%@C\!:ѱ5${~Xo}l9e}B'']Rqi_DR)x[n.!PBLGvWUlۊpܓL3L4f/E6BKހ_"q)޸^%^ܷ7r"gH%nqhJW ?̓&aⷻw,|m[U9cK#k^^RNtM`.Ù:i o[1}ϩv4Yg=涙w:RZϕ:kI䢣g;w$nkZ4ෆ\lx/#t%9Z\i)4z\&sYvq0νmx&lxLt'tS}3:Xy$7Q//߹]!9vC$I!y$*j{xِzPql˜_"eߜU^盻eFBT]PO['P 8ezp^cL{ ˾ru6œ,I=dhQTCZ{̻ԞƯb8h!_5Z7s rFzp_IQc^꾐n+U3?8c1 wCwK.m7 [#^9XrDڰQG!` iK1hC(%rSe ӱgXX ibbl#ClGG: _6^Q|~ٜUTZ}\*ITe#5n:B~ J咯b-EbW-(/X3|uE[yf.S`bЫsJJrWқ$\(Y㗨:,X;*{jC[FwS" >a~9ExſyӍ]ҩQeK|C@ʱ&9#kRgϚP0hz]`8߃^!(jஒJ[!lTp#Kwٕ\_ '*\xOԫ_T2Y*yCek1Zo {8<7# ~qs['+6 -+$ }u)psZ3Nag@)|zI.F}_XܞJs;=Q`ʻ\;Qs6wV ) B"}DF,ۡe^+|B\_xy Ivն._`i)̈AP^f4Yv\Z4eFZ.JL({Zp;咾(>cH^-&E k|sd˱&f4O(yx`vN)]]&*'V٬ë~Q#%+9 KtZlY1wKzXWlw Vi*=PF4j*8BgGϧ3#8,!bu@upvR'[`dQ]GѶaSkN6_M;93Z1Nl;MֳI %A]Ŵ1Qw9s4E'. ְ')d'f9_ҶJ&WLYE8shMi琫x/y “ҹ")TJ&cU9̕wv6k0fU,.k-S2o)ZK+懶mGpݚD^%qzG` J++دy|~ҔT#&B.F͘%$XYqHsX/>M9D3 XUD s<6 )a >_OsӋ֫ݚ_ūOUp4S5^Ց"qNmAM՜X,,ÝǑ1*I.  \W4]*I{Wr'):@~ +"7z(k D F&4m^f㻢3^6ZQg|/nxHOЯ#>lq$ +|nȷc@EX@Pn(]qU4iO"ٹN=RLb 8hp-Y"Micl&q'rCY&bW>T2Yۜm=@g+Ge]`RoyePKu{~D q0s1'&y%R_OḞ-ӏ4n̖7sV-% P~S׋ttI&Y!uT*Utwz2Ƭ2715rVr8(cTXh-ϑD:CؑHߔ\s+yrT)%] uzF!<<9u¸j;ú5%iQKnVzmP560sfumpGPYXC*ͮNv1YI {+֦ڤbM)0፬YSv"+`4PI?{wYARTR3-2)'!4}q%qN:K#3UEr0W [e#c+囃T)h|22y5 do) ,t]IGbȊsxVͲM橇2tr&ݏӤHǟ_8\x[59mN[>b}W*LP9kjm ТSw^ L{ ҅sGl_ -` j(mB$YAORDRX08GNVa,Z֥r0Lj̿ R{DbW,X[!?X>Utqy MwKQ6 |u4*2b[_To f 3liS95(A+ͳ+E |09N5vFM7ϢVЏVfzqj@I q5([<_0iUq p_WWfY[/-~ 5z/ü PvWWRH7$VڊS6(mh? Sj%/:]j*.[e,Zik+H](ou[݄@HA M>DWӄ H!Qi8 VGG*H4 ~,PwX͸^N[F9HY:, r IA u|RsM5ÿJ-~eh#Sǻ!.Q"gb$XAÿ(}!5 Su1t=Icv[ްכ/7&(+fCAD,V?+`uچ/D'׺ޫh%>D<18PR5uؾ8[l}M0͒xeMXWE]"ґ;{%rZ9`@B㪹Mu ϩ7e5CXó؈0vK~R |DVn?*Q,dACI Kwװ8V7ɐ/p.u2zhiDžB+ue.{N` 𭙅«TH,) R?{ WC7..3NJR릙宂܊xш)O(p|c+R?S3U6B$ap"@tE/~#JIHղْWL9Wgap'$0!p ט5C|PHPpx6QfҡYI+v&ihS9ѯ"i*:+wT {' ֩us2Z4Xddiu*>w7xv[!`p4F=~8P"I!4; 1Q6X(.[ m(jp8Vjf0L9`p%Q4哄zK8P_čPKWu`k6CfTǼm'-g߲r6rړfMx+ID2H7K۱eB˕Cu~YIDM(CIۤپ8Z݆H^Qi".LW^7!ӷاXm@ G,支cBU6$hw\Bs'cRiEGwE0k;Ɩ\wR,u“n,5 `"|= hA/y;W.7Q;PL&SVQE2P8r4rP_ Z-~ݠ:IB^;P Zb 欄%)iL' ˕|2nXdJ; #(whTū$ҁ(p.E~T<5٪>њk[Z-Kߐe%xǪ2P"RpxRI?>L J[_* fG6ǫ6(M ڐS\.HW!IL;]H䀸q珕 H?mT"c"]E.gY-U 3>JLzM[O&xb:q6E"!UKB S嫰-`f :`q>Ik&]/#e=.RSqqJj(_ɂe :"j q+(L3*“]_c{EVnp_35[¾O*ȗHȆR~"Â~Nh0q/r}S '՞-G駒ՕtfxqGx2q#Bs ~Lda ~D˯ :*糔c,xw=b]6ݰ7dSRX (( Q04ADpλo3̚Ϛu_H$pIMnFSyd"2 t>$%첾 馬2%gIYDv@~?xQ/B%}3q y_C5 z8vd$@>+.<Δ a~6EDa4;V :_4fzxmn .ov_`u#̝iN$}?ue_r2zӼOܯ.keni,Lh.P3p|bM!_S q ȷ]'\/ wZ貖%T j #w]&LleiKSXbFlƮ5A8Q&8>f*@Hhah馠`SZix9ۥ˜"b\3;K^U`!l%IES0E;E?[Weèu"B JʉTY-3[( +O.<  }" DjB+ɿsbVRbWVpRӑbT` =(Dˋqڲ^nFgGK#J#讀nD͈4`8=>3:A+k5P.7O}x-!ФS36FYEΌXDCY_*e=O`?{9Q^еȞ{1;,DMX.|{H8O-l\#265-/gM(KOz& EQYj0YpZ[P]>U-ҶT"cQ^_/[ȿ"E ҥ-Miyq;dUY|ҭB`%{ 8@`ʘ,tAI^;-/Qb/(c"(*Y8__䶏-{̿*a"Ȗ<0z)(= ,ғ.&/\L9\^_ldi B4XLE1(J  g Q{4Jɤش rL9wJ[ڞ^%8( SN03S?,:eGed&`Q;%aR<QӬ{Qy`nc\-@S>Ӣ9TJ~ T]i,~+4斟'fe ֩@YS3N/?a"Z0]%D7⾄$(.F+HDJ|7 i ``Tdެ.Ӝ+|?aB! R"JG\JHVԳb=7ӕFsia~~CJnA [E#%!投*_|5VUT-=nsI{8~MRdG_rV:'DC ~& \[Ն1(NRIn-"YxsTtF̔z:4J`~P|wF7D`aM`aZ|V*ˣԤR"hN H~7ےNE`mQ@bn_:3m-A2/YJseyqeSQTL喒fql0~KS4fgs*k*,fqn}}r ~C;Ʊ.vi%-ngrhz2:R3w}UJw7ñsv&n ŋI-Z Kr<>WWXa^=_3ZP ,7Ē}/Ǻ#K/g JOc{_]Y{w!Z!5dÎ ^ݥ4;x 9o*ҢHJւ[0֕Osdr/6̕gGeOX_joYzڜ;(p+di9ět8O2#6D7WHXeϮxRw3UoSr:3&ȡAj~?bln%.@HwlRt_r-IX%K(N(iM2?!ڠx)yQXf->&I (6jϪ9=m;?2+yMϷG\EfS"+i\vrҢj"$h]1p #H#SSfHvd&+SrUQPQt_6fN_^7e(zgtd e2ƦRV'SeKYf>'"6S C)Y+kah/TRB7)R'5,KK!ԒڥaIһ%ȇ_->$0K Uzl,pcrBNyTR+\Bܞē 90VzW%Odwo'?XFv1I *3$-t+MU\쑶p.9ARpě(%sTѽ;" [M,4"<]q&9aqTTiwwvf' ^EQnaO+}FZcLc[hM۔>O"25hڔX)Nn]ɏ^IAkUjz&w{33Ae$5vD":o EKwG"9K0'8E_c6,<%7BK"*DJv'&2q(D#J{1>5y: .ڈDx^0ԋONEأ !J6^6jl)Vd#hivo̚ػTLH>4OYOs{H3., 'ob?*Hq7ne5㗢r iyu3Y /x/>tie>b$񶖘oeIZjjC:J9de}mEc,__b{#\] 42UɉLiYi cͥˍe7Ž9 ]{%JS~DGqx9uDI _TI(NY ' ý&Բ"5; ?r%ƒ">(@\tO1ƖJ^D bt2 ;k(6ANq[yR)F `("O*N^Keߥ3d1r=R{tfW9{g&+=ve'˳'p.ɩ/j bL aؾ6R2ݒv順`XI$>^UMZLۧm'"2qw9hmJ#acZۭb ȿIیENop^Nv.s {k B#i }3,Us;0$jwr&2 Ini_9/F{ ')qlA.a;@m8s?i9]E10x#0D4ģG짔Ǥxt!ʗHz^@&o|{qЗ}g[XVK84a8w "ɸYV>bN:zQLwzHENg cВkȽy٨;Ą>d>D;܅jð5ސI6HRoE=ɿnF@3Je 8)4(7lDsN^/@]Xs* AcG6^Gy[6Q=Y4-mH3ĚgK#;$oHs 6F َ$v B(G_JX<715Ӆ\TBwCz ئX=Z'<ɓ{e4/5FRf5x;(N}fG:eGX,♄\[ч!Kѧ sIolij^ <4zv+~-Ƙ8c491LWk=2I+Z5rYXFżM$QSdh@iLw̒ҸY (-iw$(CYf?!eQk :?fhŸa4eK~|0M-ʗEcZ2<+YR=-axǰ A.)ujH jP_ j 0f\{]j218tfEa/ҳ%p/"̊'S=Zx9F_ټ}3Px$Zr7.T+j{F?D/2F|(,]3l]s)g|mJ5`t}m42z,-Ɂ"T>` w^O.ײ5!@K >}G|¸.@%|/PsZ tu1a9eif7%NG#žTT}dpo&k{aH2p@2eZȷ38|v<0e,/LA6Mb 'ned?ɐ]m‘Q)0\rrzJ (QEh.*>"F `kPajE\yDG%ΚgJ_t55dlևSͩ87<̏Y˩F~tY'nAx j!#7DJD_L,s$%4'KL~nʆ!8m\~rIpH1V=}C;};[Ga0=QjIֽ_H (ӆjMboL9{{}xu~B*&7}??};tێvj`H]XUF2`R_v`""t#ՋFjE˃"H7׼Q:5)Hk´]#f^ctu2'!jH!3wcH]#h +콎M|Щ&nc<5 6s^z!ё0;}EBM?}AxU"\[.KtzG-26I,Y2I W"j+JsVOab̛E-?P`*@ߴg'mJYrOTϹ"0JHh!Y%+J^l7%A Tpg-A E/idI#A|2_щsñŨ}ݘe3@~B{bexѪNe2rdYHl6J6űC3kWs⿻ⵒ4U}zt QV.[Fh]Y u[R7s+CS6[vvI'|CN9\3-;F]3@;H<ϼO$&YӃI,F4ɤ~sb=pphH%̾a$5sQu2(2c%jSJW~y뾅mְrs,qr7Zyug<&ӏ4^AfEsBhLn[+ok!bh[ [ s |IGiwtEGbN$f3nZn͖K9n7a(ry{..@oߊGu]nA?ƾyZneKd;]>1ESz8`HRFAuCWZ. sLnwc<8pp._}5K`Ax%b[fMXm`+D*f227K)珞w#Jd u[s"c ʥZ$ -];SgezimqŞ !%6Fb)t0 '1aC/-!^ϮNY'E,%<()ɗycWz9BlW)fE/讆Y ps%](m;%> S;.z IG)7m]Af L#R&JYI9ع8j|̃[M:[OwIQ97U6LY";03#&FޔΡ9,#c;\l̻ҷI\OQ/[瞰?:8Xc|:dYB]v1Os/o b!h ͅ+F(ċܓ1Dh47:k8{_m󓷄܌JPj8" 7 /Ѭt(>Ɠ'J y-T=D½jsa&9g, 523E$Aj>tlʺ&nqcLCVE=xy3wI4?Һ8'%h.egIу' ]r\KUV h1\AԋP:4e󌙄I#SR 27x+[sR\F;D(NYn0-T*{DkԲma&KAyVygno".U*oˮbZdDG+8~4Qe(]ϞLHkfb˝sF?~!L:Qu^2!&UMZk"XHzȳ&}F1KWk$3B2`7:t,Vi-rFgD f ;\kPdz? L(㶄%u20LDz/462% 0&L6?ι*x‡u1=s5O ETOk%ZD "DOT¹M ~1!״@z=cȳO Lc5MY2=M&z§F Q Ѭ|EZ6"t?C<Ɵw"({ q6 M  R=:Eׄ~bL0 Mu3".e '0G "_LJa5aC)r=Y/6ڈ9!Jcy5m,' @e>o TluM1NĴDtUtw[yDJ{lYLxiuMQq?m~0`Ѓ`+@Qd +g+I;'RyOigJJ'698wJ Rb֡q]u#]f~oǥt ҉'wKsU\y>?ڬSc>& O+d"FYYgu:/<$AFqj.9o-U f8/ra\6^gmԒNs,&k /V$9(pW'YD-5YlE7H3\Zp 5%Ă?us՘"LAY ߒo#OZVK !Iu]]R!HSF*Szt?OF>VfFeH:)PMbaCkgN9Ҽ+wrRȤ/] ged?dj |e0[#9o$au1f38![!YdjѤ?cs9~YeMcf7q̬e*@׽mZ[/p6$*%_<$0 !d #` B 29,%d +` YB=p# ' 9B r;<' / yB?@   (B P8"@$ ( E( bAC JP"H@2 R 4( C P&Ȃ@6 r H

B' }_/+ C`(84& C _7LB` ?```s_(?$^hd%KȖ.]*WQQQ,[`JUU+V\xժU%W.]f͎kז[\MMb6lRWW߹q]6m޼y-[lݺu϶mn߾}~MMZZZu:::uuu7644 ?|'ԧϟ?+0vxd72:#'&H߾}Nϟ~=9ɜbM3=͙wf?pvnN47?i'[,A\/PbY"b_4,P٢ҿxyy֫Z6rBbCO7Un^-Wn=Mmh}ZZxڑ::tWruRn7l5PL>5 6X.xkff %?,r,-,OYZ[[_D\=`N`7jnpQñssK+[[{&oO#@U>}>|c8aw_Odl * & /"t_ت0npxjc[#FDwTT` qq pu#>7~ /-Q/|a@Nz|):6um u,-#739C#8c&<+<3,{Oj;KnRM @^cT La~z ~\a>C8I& Α!r?%e?uG?L4)+um̮,08 ,xs7{?iykKWinnP ]_}b%K ]. ʏ%\ Gz4z*o} w}wtߵ{Ww罕}.$~y(}ѧ> {rA==S<달_F::tѫ}7V{x3w﮿xCǍ>-4ؗ_6>8rdc~;xr)?/-#>_,_||ÒK{UU-_\`Au+jV>v)SGڶC/O?8pYu3ޝO<ӻ˨kOnq0 ,]~b%K;/<~j˵=7Wz;w߭5mguϹ>D=~Dz1OKw=V/_:*Uk7 z;{?|Zi~ij}e{whh|lp !0HqTcItSY19DelsU\+~26-.=!Lcds). %%S)it-E0YY?ٽ#\!/o#Pv*Ax/K6J!CF~DxR@T.S/BC5%%KsJwT]-O-QQ\iP]_5SKsꏻ5kZyoݾ} תs?pPx!C/hjohow8pGPt7.k5kx(荦uMM&|qA'qs-FOF|uҶmwyӱ?a]y@mǵs羞tu6t9wNOraӅ_ʽƕ֫~W]C_ލ3=!=onAnu]Z=,]t`~#6<:'O? nGs?Hv~9?Fr  z4?l>- p( o(<͘?jthޗ߼KD{Y:mqxv_e}<]6:cx@} >zW&8w$qzIkb~Ɠ&qI!I.|x/N/ }~~>"'na' 7ˍ *4B*  qG¤ȅ6>v!M^1 yH1eƊﰄּn3Y =ɧ%y>Oz~$`>ͤ7'&# ߵ隟c}?q_d|+09?%ܺca^짶Bc F$.| gXj`KxBχl<]Ȉ沣19Wowoorh*j(!vtRҝ*(AJtw S|~ugͰ~Nx艥jo!ؚsD1k5bV5z~TښOdbM1[uƋ;A {x?BDky69fR^qh~r)1Wg.ͦƊװ4DTm–f鰽jŻ/;@ChTm_Q胒ڢvg/X7RW0J۟Ϧ~o.Wy˥cOjƐ_яLY?p&$n_Ý@-N&ozb\?$ke>0ߣͪ^ 7 [埭'>sP=Y#}qHG6}Fc//tO{ĕsս_/Y!o=cJ"_ml }c[)ooqiaIC^Vટ;zYQJ/>;m<6OD=X s-}l` &q[PQ^~Ġj.iGxpKxȳBg_* U&$_(~P9xֽ?6bS#unJ& mӀkM֡şgG!8y$M\i:A_:)n J$aqT|ja1'Fy9ާhR (Xʾݟ8"[?(Fd~{V/wڷ2LK}ѣtюRwvouGmjNl֤H7GǻҥϩOKQ"72=-/2ۺĞv+^dHq%(rfrCRT谄Xw~ =8;~^ֺBჁȆupa.Cp_.zP:e `"I&E4۠DoC8uo-ŝ2nQz8l`RlD~tz-Lž" >taU>#}eqV$E!xy =h:nzoC8~a/|iTIH-ILq<@jWXWz]`6Q.7mTxMݠ=H-we(`\8F.xf^K_s\~iL6;Y `uA7"}Sِ 1>]VGh l\xdIގQ%wI )\ gq%5jMt( J)T"dOɫU5xݣpS|Mna޵/y?"x|feLHwQ:qq~b;yoo^9|$jjd3"4AGO~wIef]luna#)~huzY^&34װ3܂[3;x=/ߡF ZP^!qDcIK#sv-T3]R=3zSwZ13Lm$f;uLZNOЯhfFPrpyFQRRJSeoBsB|'ZnWQ3F,0jl o9@ʠ( gIz<5_VEpQ qCh3' }-V+ !^̏%M!攟+#2tKEXd/V8q 8P0  jgF){'Eg2ꗠDI]-"x);V#MQ^c9ֲgKk]WVwKzăjvX5r-ja]j(&+ jEW9Vѣ5DF\_(?) GqtF(#Tҹ@Tv 82_g'Q̎QCT{U*oTGRy5s_Mj՘<7dYLVڳ+%\6rŅ~!wi:۩w?h֍rcIڭt fq^}_toC}֌Z &>- 5<WŇzQ^TRd"J9TuZPEǸ*Ckוn!Wjcq4j?G^hZn YroN9 r>bcmz`N?<'1~mae[o!ߎ]MOZ{wbXn9{W_:ÚS ]س%RO s ׉(sMŧVO'I.{ۜQځRٌΣ|}?[Yj:X;8 :vF${G?H^`-8uFw-ֱOCWz̫7cBh=MKQ^8?Qo^t]۾|{QF #`P9*nPML+R}Je(CJ8V6LP>QV rXn;61W_mo}ᾎ=m6>Кc.tGndz]*6Zg-9̰a(g|a~g9ou0b/M8tAaH6q1C ]>:oePj,Va_Xr?o[ o5_灜qv7<^tF' \ݭ6e T1Yk7-cwtL9.U'PD:P:jlFi~{bEF^dƽuHwS6<"FX Ub1nCMrܲN|,kI,p2K[,4^jX"2gO3lu?pUMșՔ칠͉{ҩXy/DJu}Ԟ }5+e؎s,SC%49ivbg_EQA%pE^OI-|/urC0 o%·b%FRiPB4xOf[A//n$$>rƒR.җm,-bq2wDLcI1GgrؾduzᖺS>Nӯş4]6nslHaV/)Ory|,/Я:sUš`7yWh9'}zwКgM-Ϧe٠K>{?@{eM,76WT,4jxQ\OmYrfʧAkn"zxX+jA)m}ݯ.=~~|P|yy ͢e1ӻ_=,M8%vi%v8-rAL@|Clu6E"V,ݴB |@*+Lh7Fy\g!UByE1Њ:_9%ͣ =*)+(f / x  0#IZ<"Ѭ{٪}k.WۑUY?;RmՄQzo,.bUw-O׷i5֡N Ig z"~/;B_ͫplisˑ kP-'z]%LE248ƫ漂-5xjK5ddLjKӫcg^vvWZՋL\fsb'of־'G_xͱy-"(OJ'Gnq%l6, }˝8ѐwό"\oh'Ptt+yZ?.O8.CG,AFG"r1XU͌qkń50b՛|~Y&# bVrIbVof/Fu+L k^h oߣz_Vy[2gb BM*iҢĮ&4'ɎGk>xzC4 !E?7(Sv- :pA}@Z*á\.fB@W#!Fme QGbw׉Y ܫ&u;u}x0Wm38 `mj~4hPР:<8tJ8(wc^[#kc:"o1/mfv ]Y ӗ*zZ R-yY{LBRյv!=as eyRTL^')2үaPwrzxuW+@8oU=u6:96w唥::ojzZ=8tl$ۅ9k O-NHC4B)YRS?XZ*D<{ w!'Nb,D2I/'!!%" ߞSĒ&ur]w sgUW =Y 3 {A2ԉe`LՄupX=k) 4BbMasU+Qatj#j$t~H1QɁۨ/j( R"Г*t0yn1l=uM0uj,iM2N 6o>7n7:Y.lՖ>QqIsu}*!L9~.OjW|AFּD\AIJ7vo-؉7muMnI˯F X,a hM[#^ar@PttB@H7wt +n"8`4&8|]ؼ|t`mh3 (ɹIvTSp3Kv>Xz4+@\!Fe~Ԓ/ؼ؞Nokv8Y37=MƍXiC>NRO{\m}Y<%$oe'̠;& C@YRO|(-hICvZ7F_/3$NB.*yc/ȋD*Xy*1Hu4 AI)8pVH׾½kgHh&5%rP}lK7TR9J/޼@<맊߅{쯯R B*}Qt.$51.߀P&! ?!DMن G.e*kHYF@~BbmY?QG<+—)Mn vB5[wfL3~d=:.D@IKtb!7B /UH&I+oaf ڻG2cd"+LVd$`JF!T5< Fѷg!_`%wz3\mH*04_ ^t{I:dTy}A/\ܟ}#z9Ëui;2e{%2LGC2sh`Kv {J/g,(R}k4 V |u_@W򕖩i\1O2?W5Ko,`]R~kDlSzp!S5c7n[Μj̞yi'̍w)k0LT,=2\9|il0@)l8̛tḃ-!lpg'sZ%9*6x$3/Ӊ˶ RDccT<sh4$}ԬG\j!t (_ @TViTa"5868;LĎ}_mojcvT{n6͋Tkhm*?H5RQ6J=j=vg`(' 6ms7¡A>煴4 *j*V69}N(Μ@=-ؗaV1FT5rI:e3~Qv}Qiʡfqw0kKăiϠskýrvʵ{^pW9͂m]{3jgÕ}MQ<5@XC z7kEWwX7#pdSeno`~f*b`o}xt``c#}hCWy'}=6յ[v͌J  .ЄB-*&ram01 eˊZˆQW PYhVsӰ_YwFm#,&PPQ8U_8:F͛ nW[- J1<]& lx'rjںwu hSŭ`߶4Cm{N6ٯU_ ;<'/ B|X Z%&"|3H4s7Y iRM: r6԰Ѣt˜WM^P:"^bzyw1xƝvJWKݝ;4+4|(CeTǶ Qw-6'?ћ44޳v"]@If6)2[pAnL$ѣ27br߲::) E„=`90`3n7Uʐ&IyHEcx CjegQavu7Q~me=c$=,K 0Ύ R.Q's@G(_8@bx#!;XRt~ai%aػD]dUx]R236<" T#欎!9%}"AӳY2i;}n{,(s=qԓrM~Wm)6oޝIebz@ae`p<-  gNyx~.Ԗ7a1+l&KiV'E2KP*KИ^r.̧#(tir}fhSyqĒy㯎G7cv~k+~{u胩yb_#*dv O4[2*I^ ηqqO5ʙt+k6Du޼_}IT֨3l: k}R6??†FQ_S%Q-eFsfBDfIY>F<*3hq$Eo^Νn}T;tՂIYeqfFCV|v~Քd׀/xH7~!Dw0$Aa Aw]ţqFd{oO|eu as)FbgjĀC e*O@N56GfgJ>ɗ~uC?/U1?|'O|Ԭ;76cg%h݇7'_UpfV R>|[zzX;>v7-Trҝ=%u{8}iK֜]5ZIxqiWRT$QWIQ|, dh}b@P*^>~;tYIGTd?n7+uYf\ÄUr1R̼qz鿸): nd ?n_,Cr]ɐFo^]4k;~`_^13 0929x셋VfVy0($_W9$D[q$R~#tUd(fIb?z3/狤BP_X I{*Fy]; s{w2D^ڋ̩{Ӵ?2ꉷ~{k_9[}^va8N[bZ Z4k_k#X0+ǽ\FK%ܪbE~+9!c]ĩb~7Jw AT2jI2ԧN0yakQyzn- 6~s:?kru׈OQ7|#y7u]akO {і*Y__ܨUA!ŠDs3fDY锑0@ZM2(ko83HjBQ?5JjG쟦 !Հߧ6Ign`ׇ*sXIۍr@|R(X*dQR~e'tC]Ϛ/C/>\+0ӂ6-sצZ.#|J޿^AMmn|x^++&ZȤ5MBBJcHRH*;|֏4oqut(şIf=n22,ǏѶzR FEe,2y-C_7|bӠn®?qBLAs L {c[GWx MR򛬪ʁ`*J1 Gw9v@gPn, II)2{+I[w^^&!Cy~Eϵ;c}:@QcHdn;ZپN@kezn`(Ki7aIt!3#%Z-]==orukd<< i^4-6MH _ |c7FG+ia/v ?6nοvNV7rWIG늌cy51w"C ȈDCgY dBՠqj"M,biI =Q&獖ŶF bv!^~>nl&F\Ѽ:Q9;nYVPXfM': EtǸ}+$!kzk׺Hfv)e<~' U±9xt|E I"Tz2RfDy8C|N1V~ebős3\/.]D'V'P}|AGi|FO87 l5$T6 2gDƉx\VQ͖r˄%VKݞG53;I,bwŮ u9Կ2O^*Vqԥ"H 'Ȇ0_5xts Kv8Tu**Zא16bHp?C13*?PMIO I|ͧlc NJ{>Y[L*Dp.-bUQCtd:)WNq^6,M4~+V;cJ#Mܟ$DN,0qN1;^8A =sp"Ā @" (TBF_яle;JC\RE: @N[HA2_`%\oh6%}|`QA-'ŭļ`Ċ.KŎD\ AӧJ0;JR$`50oDpE}ccQEm>ŲǑZXV-( ;*",fQZ¾l!U ʟQw0% 2i7oc , 8;dR$$(IѳR~Eu )/LA6UT5j=L D*z>ԏ^gU#컰*8ecEq: *"Of/c _UazQ(tFͱb|JǫՎ(Ѿ~!׬#+KVp!>*nAqyF(njmg4*]9-ev*nh\i0P (2F\}"ȐamŠ=sqRn/ξMijㅅ*34g9[֎u4YA"l٥orҴ,[mm76}Md|ehPn;t:[dY6|kFy:8hd-ˢxy7)Q Sj\JXBI谡Q[D7_EY$ s$V>''lNcRfeLy1SrwBlFG2c,+_6EԞtٌ ffۮ|lcu[PnҚ%P0p,AGíqq*` ϐp27KITpPj>k+N=9%VMz(Wcّjw52cď3bp>e*T2?H6^?}1$!U-La/נ%//FS=Yِyb@{;\>ՕyttP@tlib O ]vh>O?lhm`wYW|ҒjYزn?hzϟRdm#M;Fz=~Y6zk"ѝOIgóN?YJ%X}ad; yjkm1#)BC w[Za-Y _^ CECU $@ō'(~MJyNu^5]!"|=ϤʕpG6Y0s-,\,)qѿOIi-/FF+=}|\p#ϼc(i*뎧}eo:{イW*BR(P"mB68~ޯ9뾯<|mgag}.2~Hٕ|\ggFk!ݱy^ŽdW;h lz)ʧ{ }Eou!:^-(j ՙgY 6! kqccz4; 7=˽76F{xKϊ&J/hͭj6=\ۧ'2#mlǧK|G,+G4钮Ђ-)^(:`tuqcvPgAdPW~O=42לeX;#[ iu[FDKA5R_{5_s p&7Sl>MpS{a$LpeqD{#$T3cQ{2~|H v"4?>?v끞 ϋJloڟ,L20¿yRܝJz9g@A_=3xs{T {mkEǨGsRG*u<9]BQʍh}km;"胋x?zCşصp7W';8Y`;@݊k?OҞPTD@ί>JשΣck8s/I)N1eC׋WG G?9#貑:1Mt h$阨V9׈n/e)rSʇj:C;׳X9mN}*ɫA[]" 1{?#W;lij>ZwY%=:8 k n&9<;(.IK95(cƧ\v1-wˇGĆov05HKMϰ؏%{=#iZjk:/nrcM*CR㦒r_d'ahϐn|?Kϳ4q3慸[{I?op{0qLؔjCNdi"TGƦEPde;Cd\wbD f[s/Lšz`g O aqc&^x v%@HMsrjG`^ޟB|CoWG`>Kmz'.p0q?ct{70^nf黦v3eB'KWmq#ym-X>}0#`ɇ]&|.a^BoOoлWBw'` ?394 y?*m Y O,HcB'щ3ѹ͙ B|ڷKsL=q:.Dzˬl&M0.npÜeH DU{S:7f=aAb>[ mm ${>Nژyh@٣6xw;8uK+LjHo^o~1Yk20Z3^[^T%R2ͻLyrvaڦ,/e&|T5JXT2j9jbg8/q) x}U;kpQ޶n6(O֭=f@p2'9&Ph;czIyu=}Nw!=pGT.k8 KbD]pXCls ˖ &#g4(es3=g[`)_-2{6/өͻ"AV|%t;</e{Eߚ$ tH#l  ؗ뒈]/U^v$/Y32r( _S\7$5#tZ"x6*8nG= .˦|P.)Gɐ&I҅&N?z+8/4c/U 5Q kFFa\f 4`Fi}brti?4ZNou  :-kët T#nyYscBהfR @hnƓp\L~G#I еiOF~  Y((e~n}Ihܩ7uԾZꎅnXVf~j7lE^{yь7ȲiG Je%ؔJ,oc (}˞zWsA:XYT6a3*Cjc:Yb[wf5_imceU'X5sU}^`XnX7&޽ftY>E嬌v"%mPoMAX:FY?c_F~^L5Gtr^ϱNur_2s ^5m-W1m}'[ l n[8`f=}SZ`l: +[&Mup׫ɠI ]3Faqt8M[ Dqv#^υHW{T}Vg[c_>\=(^|lu}/Xw_Y&ʺ?cBuvqd~kO[6|zK4k6}dQsoV x˰S#ˌoAw 5bsңuy[sʹpؑqS)'VxM!h&1nHOK)4y%Ն`ek7b`М Y9Fq߼6/))W-Uir.oLQ)a6جE(ĥտBNYsA@7?':f#5>ح,琒g4ĦH;kaWpw $D;a|6܇d[Y(|GzH/uF x$W׿k].d{_c#Yդm;eKײ.rڔDhe4}\g|J_VaZ i$NluDm 0hl̰?cۻoIW?rI]iÂJ̺gQcw}y.%sX/ d%\^M^0Tiθ鷊^_؟pXO&_v7#WYeSǪ &Xu()H\ꍇU7q^.훚穿 /M.XF}EΣp|ē6'6[W8n`76_8µYW:T} Mfg/X3Wadz0К>[wX2i%ୱIS{b B{.׳p.s޶he2r\CEW![\).S-lAtcls؁3rbl?ä# <pHALʯS&f [y'diGDv7o;3S. SS;ّ@olcv' wWagg{:|L<ϾzdW.n?[uoP܍ i8}sx\3yRʭЦJzX3|+>fAz2ҿ9йB`79zr]&*Z~WY:=s9dqwfkGVnJX%{18`]OGo3*iYcwE}w߁$ј[o`#)p(8ֹ+TިϽKG?IE;D";ް3cCҞQB}醴x]w;u rdȂ7_W/8/z5.pwPtpGeLVgz{x<-.144u|W7c|jBlيFl'$ʭ g^Il1;":+ wQq8_y{R>4<ZE} Ϸ>M5[r\0V?n@>Q_#|N[yQ75-qʡgsfIEZоZ`58D8!Q5F6PIeH?gR$&44Ѿ"-A&ߍ8Kl|r@|/>%G!G=jfګ N 31JM̵.Ѭ%|lGXO9:ra47@48pLݨp>bZ wWƤI!0T( yEO>'HTy.ĢC9˯QU*Ҿ3Nj1 '4cz7%ueŭ!͟Fv^}F>6eA; 3\%NC%LplOb% )yu;Bvju?{ŀ bpb!ƎR_4&Y?m Q!tA;J ;mg&r}8,FfR.@li-Q<[& !i9LyqQn/ pLO&|yQVw(qa-G JϺzyc#7ݎ{@-͍žN:ރ27{8F[}ޥZsb?Vԧy*Mc`Ui_ȣI8} t ٬*?~1y}W|~ח-뎸ML]l\SQ+/V}"T(r([g"wZpP1-JAC<ױn!q9nSr#v_ae~].`v_Ӧ$~aduo6ѣ?DҲO~Jkc8G*po[L^PTp8foxgM[x,(>:'WR.,(3`kjv ROY?ebz 9Tϑ\6YuJh5G>hf\9cdi:Enkk N>|V )y@ȉ.8,s#qpx/|r7:#[ 3[= S&Svؼ#'U\dI|ty 'nmqȾщwE }ʵ">jsPҀD :i=! V{R8(JK1@E\zjV63-"T?5F2v_ \6s'X0ujV$QxIp F[RTԗ`$'!:iH1TRW!,BT\lۂ{,Gl.Ȼ1J Uæ:tTy '.FeP'67rUmj!5p {4%꟒D>P_⢴ʒe J P~&z QGʦzo-3["lxnF'1a=:MKV3֫I>/hFa:ZF H,nUG$O(+cWTQvFxr\Z3߄ؾD*mnH݆1#Nywj D3/[ @3S `TrJ+ґֲ]H[_Cxz>-jsOXvzi*ؑm74J: cntcOgd±Y 2Ha6A:_T!LkH%^y`# \f)kxx[zD!V ?员eӈ۝0F~&)a6 7mYF˂N _YoYU i['lKemM0ڭ1>Vezvh'6a)QU ֺO[Ղ I.<ʫ!ÒpބbvN4,>`>h[JXƢ}btͶOϲ2kv m |Pw~>pb*o:QS]̈?ֵܸF{LSy\'mBiNoщ c2uy=ܮǺ c5-s0է$ PW-k;e)>Q5 B ( Q,a(%{[ԅ߼: [sO,ovqkO<о9*yF҇çz޹>-^ 74_?4ȷv-+_n6FXougU|{(jX կk?}}&o~cc)켑& \Us OZj#~& )ԻyọEz(K7| imW^sv/XjEYa^rBganetM1=TϮ:rauIfY3dTX3s5-O;3NĶ}+yz 8&or]Nm7Jm[^o-1"8p;mq,40› [{r~nm8AT/^| iăVⷥ_`J>=Xm?#hH/:}}H{a='r=W66d83hыUY.*2 hry9ۅw#~f%>!l pF0OLcM +°$uE۞0 {Nnť^: sr<"po%مcѫ~Ma}S~+U)m!]kWH5,>Aܕ_v9'ьNW0ZmEg`\=ÝĂYaVgϺJm: Pap3I~* о`ab =eD ã!;ufǗzFKo%;Io4)z3:.pZLYHҸ-Z5d;i^bzHq~Rw~wXUh; eÇTj)f*=f/Zs:2#mY)4ʊa)MU!ջ&cp1:?^wfbR'HWTw\Htmҍa/O_|=RG4~*{.-g..9a-d8Ջ9h ЄNcm(,wRo]E6As'8pk`fܕ.Б"cqoEDN|' aj]Ju~fV2.$alZ-^_||O sWO>WVtYnܠD_3zs?{74ّ|$͆+6wQf_+[=N^'mmtA(L_ĦsfofFޥ!8ƪ M#;M:]UӉC!Yҙ2Ǖ3<l]\3{VGR}b_ĀԪ=8Ȋ&K|PnT9wQV]>ؘ~q*ȫ6WԬZmQLy_=wa߳{\ K&u&4ͼ5]N91aq̟#l&:;y9<$lx1ݵK2?:.>9rU0Sףg,W"ZcN{Gxcn>:}:Dd9ň18"͘8{ iQK]ψ^>ԛUߠ ' "AXon_>_{7tޅ؋L[c0rXw9c*Q*ZWzAͰe͛$\=Axkp47:{?֪vFi Iύn&8Ȑ>R v@'PoH*ix}iҾ.AïW8}E#742ƯGDW <±\{w0q]H銜xTB0>B]xٴxB)0>)l.?%Bp+?^ܜDqFmBlSl8جsh9(A|u%Ƈy6˽<µn^+?ɒn8t6\YAƟKapb79z(a!.{ а ecHdn*_)ˇө&;+7=I7#~=E5T˛2*irHO O-u)͢lGLf7c;qOq_lqM#]9n };,).bWYQV ɳ"e"= Pm[ GsB3N Isׄn;(5ln-!ec.25iƮ@JR>v_m;D(O@$by Si\̤Jaqs_Ɗ?`:6u$$Ztal@x-SוLu@.5crbBʷ{ĔLm7e؞JK S\Q֟AV rTb.x}y^r^]܎s!)w=8/7it+@g#;.iebi9Xÿd({g7yǹX,c;ym.i [F`E(ԿuΊpnnbO`kX`Ĉ l$GR˨ қdԼk_RM{7jK pPä) nG;D5-^jUaQ54LjEK@ T'[a cX ZIŒ˒0}$]Хu-lSytZw<Γ J}X`3 OV7ta{dULFPdC2҈l[)r3RNɋfށ*%)/*I#O%+hcV(ӧ6u¨' Q &}i ̾Z2l@DHANQ_%;tcl9EYqc~!쪀Xzܦ%J?j!\923JW~( {~V*"uYUpiAedôl2/&kY}Uo)%J5%Œɰ, `5N VB{k !ψ"~止4—*Sl1q}X+haWOiDѴ W(:QSd4=+\<ϢZ6+ b6**r`|$T*|sFq>&m/b(ˉM;Uo_p:WOJ>1WEL`V5Gf16:c;jYgwe7ooNzgߜ4eC|Ϝݤuxߐ=5h_I{tJARaYHkjW7M_*`~sأjjIW;lP|/|$rc{nC@=[ j€ UWV%h\% V0[F>ݢ&v&76:%gtgf}GqZw(!3BA!J:EޚVBr9Vtb9+ $#4%P;ov&6>1FUռշi78 6M&QͨDd ^;ulrCR}'Nb'αt9^ŧZSe[f\짩ij_@=s"Ii2h(BEfpL-"x7-yTeB]XRɚ0bj~Zzsg>Y Q; &æߢQ;7,TtpK$CT딛*Žo\ zywH*|~u^!'y rAIuu|ڀpyVoh|5So_uKOuzL{|Pk?j$Ӛj8/2PGv׈E ΅TFZr:<RJm(RWf<;vyV =ԼBg|W,D (m\aWil-#wυU'$YxW=7wE G]s/nb;b'bCBz_o45h"Yu Xs gEm7m%V3WڟtS5R=?uCCz`$ꃷϳ?b~iRG;fV_.- n-%m@wHۖߎu r ]˨n7ϲ8ӕ+mèb9,b 5'c ZL.8.zHAN>Z>TkE cl'ǶToBg$Na^E-#YԋrKeiG>lvK5j$)b4G;sPalz:O$v͎MO]Yפ;VJ4?'4E:8[BF28jIt9mͻc52L=k_Ukf1O?g_L^P'!S9$6+> PMXCbs ko\aj&}9 80q%We]ucXzk^ǜaN]hPM~a[6fgcbֲBE.{_[r&Q*y _ǘyjaՄnkb"\y_}OKc3ĭGﰠp@iWtvd<6;ofuvQEcBVRSY70XLK]_<X;f[U|h&nk>̴ܳvC)ڳʧ}Ki?>LN%{Uۑ8:DS L 1SAqUU_?Ю4K:}1TKx˧+\m/fd ;ܟ*>r!Q-eϊ|ʋkG~;$*N H'SP!L]Ɯdd8ҹ+ҥ>X/EGWߙ_`?CL.1\';F2&ܡԭO4vP҃?uOLս{]ms`5]] t#HHS^)  ?K Q~܉F.7" XpտyMy&?%Ԗ -~qs[>=Tc-O:F)4Ҭ.xS~bnG%2xF01jjKe1 ֡ 5oa|דZ+_֞ArҴ,$(u'i4BZ$/LŠp8%RORCHOs۸/jcVA<4"%"#[pk=P5ήt,3$7~zv`]>l <'hm9Đ ]/AZ^e;pBUSd&=Z]G@kÝYfxF^o\iG.x\ıᘟxj]fJ?wj9#PQ V|b^^oIc`Pt??t*3a]uF-GF=0aLO'TMH[kP9r^+B pAtCVVn'e6's.5gNƉ'.U"j##hO(QꪙwKO;)GfZ첛zUT20ar5HZַj}Y_iZ5P;'_2Џ>QRԷ+/\?x,ld6<ntv}}y4bQ^pm(? ~DpSMv0j*[Ln}2Rjf6H (ZZtԿk9 3:?c8W fű ʆ|1?= *5w{s98"S54qWq?.t9p#~DZqo*~y/3?~[R·9xt7λ?R0Ɠ]5CHGĩdVBNR5pSmq6$YatvQ  3*A*h:"n]25Vi8FOWWy~ xm#s;pMw-e GJ. {mcwRԲ(,)JE1H(hG_Ϊ3,f('x (^V]muz9&Ho95 6" W6$dL(OYg`7fr DŽo|tDF{*TVïl%LK!,$T,В2-@Ί]~ O`7A&('ksոԌ#,{7s,IUu+U(ŪpyU-}^oY45'!&(BG֋K$I]bд>ס23l6Q(z. kMZ}E5Ifw]%}_Ƅ(C21 9WP2m2njg^ 3v-}AZI#qThIzp(*21@Mmu%>z<%ќ^Jp Xg?B:(" QFY&KX;TA89Cv3}nij&Ož9!5褊MG S#=!(GƯdy'=e&@en > t#@7]lZw*S,-ѰQݜ<ġo^г`u&}Y92U +rjd!Nyn(t}3bOQFRx[Չ9e}5dqzbDGt@HdSPw*!QE@ o}y0T*QvbX{q'K]ߡG14E ݺvun2H;v2^ף0ĺƜVG\FJ ,E!;Vt uWN(3CÂFOf`A_:ӱC[n)iC~pSۄTz_(CR C!~4\錓]N!m{%߮5IJ }#K8rXc46;4A_q5^ kʖA/2\\aS2O"7_;rC][' ]7$̹aGx!bX9ב%Q1wTy;\wsU6o@]VsfS{V̞oX^qeq}RgƋg=D6WWnJM命F[kNfgiwr m]N6asIؓYDP];.u,.m;;JRQ2A(7۫NQgňt;-O~M6zﳵR9l_z\s+b$g"iBPWJzк|2uӔb4fDRגJE*+2/]&:Uy>=Iz"ÂDg5ZS4aA'9i[os[ @ZL3|ݕ)_YC6sOw0]Dq1ju㉏Wt'yfO˘gF/Cq)i a[s>n\Q]E4 ]*]$97ːUj{tE)Migߌ8 9L7Oέl^eg9[ss1#F8䀽*yK1Uc"ֻm#¸…I'VɆ:BHoX:tGK"C|v=c]:݀,{\Xji1ڭxƝ7诔R`%aŗO: Yu ޒ`4|?93o&c ԾX1Gd+vZ iR6Ērhv c؆oUc{^`ؖ<~>~!LNc)8*Ĩ)OEqycQ_c-J4L؂- 7(ڪZd'ӄBuDCl%µׯG JVEHhXb?S?;z2^1l=0TpD3t%g6ɕXNkVj"f# >ݳݸ?j,^ȕ8 &m'~JZ=2Z *Bo?"J5'Um^,Cr7h;p :K ujXƢgfbXHG=sZ{a]Wplv79~G kȦ $? *֮,k>➲Ձ`/Sa,hTDztLO~;p^"ֶ)eO%8/#TI<DZ:[_\.ŏF?bzaqFna4໸Vx/p/Cy.FO@]fHm#UP GVIl'ڒ }ӸDfvSf{b Hз~)Kh#*ma-F=3gQb=#wkw:Yb(l܊}вjeyBRpY)XF G#VQ7 T]Yj#3S-=l`:#=7ܤRShzD=FybIW<ן`, ΙBt>ӿ-BB痻JVvԋFZfvr 芺v@:zZp3jP9yzQj1zrK4s{4ޙ~2UW$k, }TDH(G #C1qVUoIO|oa4BHDk!9];x͹Bv<B#NĤO#ZU?wdQq.RO@_?E: btj["# 5E~Զռa  eMX#%#j([e.  72?)G}Ò d1H4.Z8*<^/\k:AYSa6@9= (w!-G{'GS/s'!&f1O1mk Qn_$|=ɻ㉣vۅ'.$WR|UնwrG-VĤqdkPX8bQN'rLƒ{yK}eI(%yA&mg}oBRS$繀5#s;W=2tWė@OgwV\8r=! m=2Nի&k/5pM_X}q&},f.rFRdG:kh2ڋ]+ϡ$?c)wYJx}Vbs2}g<[( R7CIۢvϨ geFgBQgLQdu{1rYS3Xuu:Ǜ+3O+BnV \6.ExjVsp\=M6)&ĠAJ;7$aÆh&qC_1牓f[ ec_g!t 0h~vNT$kDa=~tDCISmwQ]图 |EHlxdꯒ͡nё1"·h :ӯ';Xs{V^@c|g6n:B5vZ{ҽhն_-Z,u7_+漄s~"s_1w)[˹ 0` 8#{QQH#E!2O,u}{S-Ά%V \0<-I,|ϛck7O=K_plV6#Eu]km?c?n탥 qg}仰]Dɨm=HwTmcnCWsg)>ͪ^a9Ut)#2^iGZ'y; AD\JŰ9rr =\#r~Z{#`Ƭ;[nzo>Sk6!>`-\%x+oyK0`=hd4q2@~V3 kXtI &S/">o4g1WI? 5P%9A0`1՞8eedospӭ_q;]#wGrSCW:MZq H"ߩխ|8^{R ,? %i|]RG'J~ypR_Pk}rߘ\u$Q?_rE ap%kSimS* B_BSm1c$Qɓ5qM ds a1 z-B{e͖H棥Ndaa44>]Hg ^=-]M4VƖV~~p=Ue_y/Ւŝo@ ]*1p&voWqؕsXv`e,7&})9[wÈd|*ؐPwbwg ϘF6Thh`2`;z꘼\W8rzJ|b5iHLY=yy\8z7@ʠ=>cg-Uc{^`Knty|ތՅSm=ėJ.w8kp@(rT5ʯ tj% f#KKClX1hJLӣ9$6DJQC /I?Kk,"GRVpU/ghsEQ48F4]0{@UYl ;Z*_*6pD"}I,AKK}Ē֍R|L> P>4W/׹m[zbkS:a]>KYo|l DwY1K< ~` ->jdue,Sgʿ_?9ڀ(q?2c|~QMkn22 CJ]~r?B+Y B~d74.6.5^ La,8[y/ UBY4OS<}` ;x ܄mЕh®–QlxK݋@f{vae`"[q+) }2ebm[ ٛ~Vivݱ`*8m;OHph#A.J),B!^#Z?9b^;fF ZWa!xRq3nbz^ªٵv_^ƛO9C< +8]@^!R$ Ml|Zljf?/1f"}+!o-\;Et7o%D?/4|y#fpL9bMZFC R|ТbNӼBiESƙhXꗭK5zpS'A)].Jz%e5҉JVm|@%~gSY(QX-v5bBԬbG H9CZ!C\J"صxTへ0{& vsڣ5<97I,d#c,` -ZҐ?f%Ua pEޘZf@xַtx^egyZWI %:7V}F(/DM !ƜGE`%X۬K!1%X;:zlq*-u[5SM\+'5{m6k@S\(.[l[2x8l6޴ݞl~Ư߆5efJ/y0JՖ/>m HYpگoy(}SȖԬCR:c@'_}d=d{#[LŰR|If ˡ72T]1WX[GGW_>Knxw.LSpDT)ȷ}aay1i/kÃfN_DZG?+@)ܿxV|cڀė<4`@2yHBB??Yw2e:8PK"XdvR@fli>h٣)@ƴW/yx%ri6:`Rw79"s X>aq̧fWk~G*y9߼t+X*B'( o:PZu}=RЕ'C+3v_K^xsK/Lwj=u}[^ٷз82^?iݼ22緮̾o8N!Q\cly<|"󞥙\=l"uL;Lus?9~+63k'wMJ8b{s|Wd<~w3F$7{}f Odn^sxfWkꎹ`'"z}^nz:U&[ w`8۪3k#1nfw;2m %ǩm~<ӎSc9w8cT1=Gog:[_nbm]׸xvJNs}W;Xu<|U#i{ݼ5aͤ9jM?捂co}E}Z[SNӃeW$E8!a0+=>xԷE \BdsΓz3W~97xÜ\{ɜgk`7%^Ҳl+zA=JMZ.W=;^\EenUY@Ż{c[/[%~ =lH_u(lIa\ˮ/R҈{ێDV$gl&Im98@,S ~%~Q+9Zh/Pd.yF+xdIJWL?!D_ArjσE|=vP#VzkVχB6hZ;\U"Wͷۜo\enq.ȷ<rg6:kx`8iQnÕFY/gn<ݿy'0sbMf̑=:wX#s]l3q돉pKUthSr 1dC7t|xk6nif_lY +hEa:fshcSQB1.)ъN_pp_-!)҄on_-_ÙL#密BR~x`SGb% ^ ۬H߶6]^>lY%BDpydjd^/7uz.Zl4y,-3VA1Zrc4S^ʜ7;1lW;mvs6]'~q=ҋ4|/λ3B,:ػpW.{} 2'v~zQl lᲄ&B  P\%H0oLE9>90XTcbߑ &/#ZGDXp9f4ΜÝ&>,Bn[*/\!3ފ}/hBȑ(0AȯT$ -]V >DMP*yG!9EK76?*QUxGH Az1qOAo?q~m-^6b7s=M>nx9fp6AWm=v-@o꺍RtP43VP**en虠_\$đ?6rCئDr0m_P*__EN2d\?ẊI/W~ .i]{b9cD~wJ'YMx6VoD?} `Y)7z 5TG(V#H\kewD񞓁:̗)HF)nCQUz/w|˂LdPxۀqVn˥¬A~bgj7Ns4l}3]p EV(Vl|pbᯫwQwPEO,Xd]G6Jlɖ+~ž(y#̛/B;;'J&|c/A2 /L@~h! m?9g\3Ua-F`wNXs3QXWxe!ȉ,T9mJVnʺfeJ`.K^%}6frH- IFp'r_m})bK[5SqNra$oFpNr.?^V3&* > Bp[sF>Â! 'K!6U{%5|M,wa +fn̙S'cqc H/si= 45kT*<UyB_WC k=;M~^~c"p򧅠jlb[HP1|*yՄN>i$o~SAHv'}vĊry4ԿPlv+\DfKL~'wIKC'-xXL뭢jOOES< uMnh F&q+v/Fz 5OW(G~DџАn> 3ޛΒLavܺÉlc 7a%5|KJTk噠}WMT>AjЍ)$^+ek{|d@oeRy ^>˞WYi ֫l.- zx[BՍsAS:y.J+iƲ\:i˸R&{,5:UvutD4Ч{CUhwTEH$棒ԩ.ԉ/U"AΖTVtL0?vi}` cisHGڗ9Ӊg ۣviQ@NB7X(8B5Hzt~9M i"K}.:l$Jwh׵__Gss1}O ШxgIXSQF ;r1JRkv@B ѐ,c~u&^_iHG=kcuE؂!yS!x}P#4BO2!ϥ[ z ^dhQTP!-,4%,?_V Mzœc uK9|Q/7@y: l㨯9?Eo5Br-rgGvb,t99-νw#*v>G:^i{* ܀z=ڤRr,<WX7Lò pߞD72ySSE1gbu)/pS*1hRn+I1jJ"K=ETs tdCpy[-HzYzuϘג!GŢ.z4akۋNfwO%;sFYHIAn:ki 99/\ }{?ء6?<:<926)>EᒢǴNJH#)־2MS4oÁ|Δw t?1-uu 2 ս׫|;#(XWt#ǪTW4#dk=q/.#t'>gt1&DdL2~ziii1%]>3\T]r2+ŷ-6ڭRYw)kyҧy,/]SrK+^HD 9[""VF6-zjOr͕=gWJy\/|ϡ7;G-1>Ya[Mrw #W,`!ʱKq}nK님]-ɜd?gWf?&el x䅍a,ךgOy7^Cφ"KFC,3NOܫKvSPI0"%Wʟ)gݿ'/;}u#FsS6aairv]:ѬgKL \+O.qz S;w2,LАLʙ.'y-mfz(IơV/o" ϥ.#m[UΊ"^x681C-ZWmR岻} 9%^,3_>&ߝs0O}A_ (op1+8krvCW]myVP>,qm4h$|j_YiqYnk^1MkEj*gд/la2uODW!$<^L6]x_B\?3@$|eֱ 71#|:Nm3 |=R[fP{Bk'WOżR[9xQu|̛* ^ TVZAA(q85[_ղ~8y~S[P[e4W}LjXy3B2y~83<7G2~ȟC 6i"`5ogbcf' F(MhN 7[F_\t8r#*-yk׿[Lt`몬U{\+.' .yȦ>#o@LIa! ;dbiXb߇+@&x ts%Պ& nkIBshrFM!i ߱tXJFK|yxR^#`l2UocI<(?$>Sx*6ɿ_&j#MdU}jĻ?2QqY6t&퓇P>[YxIKX%:Al]ys%a gB9\J&ʻx偝2Zg Jx> ϵ%n0q8']c OXY?w' BB*~W=X|G&;> 2bXذ kW6⑼uo5Mlk%萊jFUlRypYw("gec8c?A6u“8 8w g4_ OiuA]|D 4G:rEwOW9g|7DNsћ^\o'\&TXxo̗ J7i]p]E G ~+ \.b 9tqlJE{CJ ~Hu54ATqxWԵvol?8%sx2V B)"Ar`}-ѮlEeM:X4Tȹ_nˤ{g 2goC2WHϢMҽ[5{ +T™iXiaDK|)OJ*[o5x9x;D{ww~"8&4~c=x_*DL1FV~)DY %j8+ZT@il%]@"tHAQOoG t -U-D)fpp~L<=˙拖mdN,|vpilq~kgN! |#fNeS8IEe&ll"Q}_~X_ o_;a= >D$Y$ GL%;O{=?w-P)x;NRW9O=1dQ3cj@ۙF@90pDĘ{Gɖ3mkZl*T|#| p~Sl'K|[M˯Pj>‚YR;roF[8ӂ?1Qn"[ɽV(5GRͶ1x/;:tl=5VHt<+VM[ُK-&rKzA7Oy2GA4_"i| ّgy!r˕qx.Dx{C pOYQ IvQMLm8)ضNʣ{fCw [x>"bRE(/IEű!Hn4WގSvO7. a=9?\wl1ۣI~l%lg$fN\70WFofZ`o9z=)&Y2xPb(`_R߳2`oDS5tCe}9>-P|؉=_}wʱg\/ !I#6aU,rG^~s~R}UXy}H௾/6Y7 sj$A#KCQQ 5w\<> c'?>܈mKuW{O i2*8obd#d4}OlzƬ˩X^[ofnxŌڃZ6 a)&cM7¿43Pf۱6mHZMEJ'H?'6~(F}hsSyJˌمrp(Yf+D6sZzOXݓ>W0ԁvoZJL!t"D7LAJuŠpؿkxyc NES͆7;yk5bP1jx;(}ZI]4E3+QS2;P^Xu(rW<,y(DNQڈe4%wк|$tkCm^sc.?XTmZY~šO=E2zk[2m/9əpʩYG9#*NhAcrZD%85\Z{k/_$ ‰zuW9WErQ˦ ,yE1m7;R-K|-|~ء3ڨzYQ/艕\5٭3mڷ9C'W`9t6sy>}K[eձG߲3`uijhpׯkVWCyqv] F*0oO{gFlSƑq+lR%.ajNvb׍V>6|o12C/tFy j@`N\q;}Z> n'/>mUn¥. d(;^7ϴo؏]zӝW!S:~y+'RU^OQ&>w5qӼO΍)yQǹ^ͦȪ%>?AdMưZۉ0hj󯞳 sogzj1#|jT߹LJ<8=cj0 ^lר##g]iO9Oh~ ?^/r+ܦ󈕾GݔFh KW՞Byd7fj0(nO9m  7doo53-#3.Y/?m߸=wƮ}ڃ'}lJ#d-a=WVݣgL\lMx"iÐ(ʤ >Rd2h~YLʻf:wӛ*D%v_{b]IA‡w5~aefU?frv~}Zקy/a5|c34a+tڸe܆3]#k+QxRr,jV}lB-«YMNxCYVNȐh5ʷOxF/~°'W:$xI/x;DKn=yV>Eyh>zN*<%;+߮|it7O&Mqj~>߾9)}k9gȦmbK~X+|p_wT~)ϱ!S>I.'zTFKv8wCJwL`wb6}¢eb3G`~Lӻ2Q./4(>"LnRY%CԮv_Dv,⌚U4WDZb[kk'#j.ݏבkFD_ C^\ ,L {pF @ vCr!هP`>=Q\i5m?!zP6bd.c|)Ybe +V$ݛ瑘<' <"iVX_/Xȩu,F{j+].-c-Sʃ+`?ifp%R-P- uj9InpP{2/C3H{Ɖ y7/%^X]so ?,x_ w5m'<ޗo%cV-Y/H`ht0r` 0U:rLF7"_`ȸ05. STxhI[mޛZ }a֘ՃY Po=<$'mױ{)7l, H N5쩬9yGw /g5{,h.bqwx9ʠJba 4;`^@wĶi 9^ΚOv1ʻ*)&jJc ÑsM8J^Y!i"+ݯk8`mQ8mRsw^.auuTgy$s{}]Y"fߩy"`[ZP+ ,{a9?ܭlC2;]T#.z(٥]͋D钋My IIN%ݹ[vIyC$ˍE%BWs"m [ٿpثg⹞XU@\́4GOSo8 hNͿ(ߴZqy#Uhy_WUujE|l/xsJ2GIU#jD*|^$ۭT&ۇlx #CG$ߚ抡 #n1CDǹPвqEAa&ŠŤ \z0=qLTl^r1I7c>Y`nLԠ(ΣENu(,W#J8('kA0YYS`{UDSB7qΡeR; 9(N,j?s ]la,zLj4P0H̔saPlIl&2V%܃9x B7I݅5,vu6QQS>T5[([pt?V w#PcQؿWȊ%a[OȆ*zgL*X!rp<2s!Tt X,M~|Gqދ3da=:`)rb`m*6E#񧙳By=>R = ᴁ.:`3 uU[:xl1ہvÐftxL [ҷ<5rWH~ U'[=0oxU&q`Zp앶'H}ja Em8"o~XCn߶?LEg'L\3:kAU>s TO=NyP+z9z}Xϧ]/ Nl.<%Ռ~p\ϩsz++c#FgEJt;ɬLGHpRKac^Ҍ!ٛ͋8 dHBu=E^7UrVYϫU#]8A]oYXu-2 cEKr?1Tҏ!~ɽb_/{CQbκ1Ƙq' [ƌ.i)e}:o#8o6Z[~ Ki}TǺ SwCD$J]o`nWe6*Mݘ'krcRjұH I|u-r141Mp CƵ@ \X8n Ы @Vz_F:6KNjJ'8Qը-K G?R:w~80 }Çݍ9DX4τL ]|߼?Tn9ReGfkM􂟧;xPycnwם1poMEv#\ײKcˬwvDk22ٽ)yȬuRG VD9&Łۜ&FsEfa6aUZ*7Fo8`gC4ZwW]@p8]+G=M߾bZitݒkL !q:^?Aؒ/.\XߧsO803фJROp-aY_#)<U4y R7MAr n%}{㇞rDWo^HcEvCeddÌscknXkE]F :}Msʤ/yʿ?t' &!wjy:M7E}o{=ķ2r-r0=e;vIAeOgꡘL=ޠ7Vޱa寋w\|G0)vbblE"}?0jpMfM(_h~=TTOR!|A^$OF~Ԭە/3fC**W/v}U_IGn '˻@W]g›mr`( v7_~x'|eHU8(m~KwEC$=䤽!3^)NH3'mbܗ).!2#_E'}7jbƀX-zl}+̀Ӷdfà _xP `cG07}#d?Bϭ')"a0f՟+qs8z8~h"e>-&hU?IgF߻_1+l:Aɖ?p:xj@ٵ HAp/kA1pW<6EE<ܫ!=Ij#L }lNH?hƱSkr§+u-O<nng/*= <* _}!Ӛ[ u**!<ٟ?A0 i L} C'Q _<50h+%ܲ 1}yV]usL/W^w Lj6jq qs ǿɮgYKYU lG/4-b H2tOny _@ma==o&s:NQ؄.+0l>gKDZE~vw9W4}29潕qDt Xlw(sW N fp"qOn5 B*?& b\ A$i EN983hiE#dEG=*՛dNj<-q=T wb5WxA'E̵WV,9tc^_̖ lLh]wZ sJs$xX~Ӣ~^QQvsػe9b)MOa~c4_䷃>w7a47 F@ܟAk!͇;1Õ p<?x8)Ƴbe8N*~?10jWa^ H.G3ܠlw1Dhj*ۙ6v&-S"kqqC-F (; %(7nk<Q8ytkL{3ׂBy44x#XW{W)̼O!Mb8J[ ǃgԆs`F?aJ` ='Cbifs7(7i{YfǬ2Ne;2 !rjٰ<\0r{Qan@T$HߏBQNXZ$85^ X{;J`4Q/,$ }e.f'u59Q,ԥ|RO,(}?8}`-B1xJy8a.5 ߽N74Y|Kk<4}M$2y2~xK_'dCݟ,򿼯hUYߨb?9@e[# [%87ą}GG轃(0d_ yi sE!(>sJ$!7[S9C>'?5>\p}(/Hr~MJCk2-E>ѦEXW,o:E`TY?.J)}dž N!uH6hu$٧,fn:>@ B#ߘC& SHz;3g}0!ӗ&˘d6_lsRG?#>b`)GS gc*8w/!/Ϻ/&B=g{S=j~bwJI]@ꎴƚ{L!;yFҒ]km"gD,Yhm2?'v~R{^8Bk7tGVM+6د׈Gnn%A*bRߴq t9miqv:ߝAH]Sv"ox^3i>\`/b;P:@} \VvήUqҡrӳgJ߭r4ebꅅeΗ}7H4.qߘQYޅ(KkolT:tMKp`ϨEMd{U2Zdvbݗ~6go<'W(wx2őa~spVcu\Dy&%WZq#=j}ug{gȲ=/}~-;oL_u"'bN,2ukS afd>S^1I-7L \5> r"bWƼ-3 ҺfaW])Н;tgh_Gs OFyP4M/N/tf6kkye{wՌMX:3K?xaqeoƜc>rs&((_>AW(5x&v갷uV[=vA25|h5&Hf$Eg(}8mF~y,ce:0R==)0%`Jzwm.'^o;#6YXq),c7[PuF/+?Κ;p|bslzxN.Af^+&Cnz'lEˤ bb )IJ=k882/ Ky'ޛvoW]F*xAl=+OdOB$eZ΋1 Z9~֝<9Q|LnQ6ٮ{ӖXN_79JOdVFEF\uvY؂rtm.i6w;նc4W%3%#Xnv zDWg?ic?fB m 4HA^ֹFIg'-Q)]{˾4堅v^oQY2s~b cK<EFߝWˠeevwf#rslMF،[U{ )Ͳذ"ޯbWihjvN'@M*gd߶$Ӽ?>PܚJr{.fQzǔZͪ70B6UZbZcI?]9 O(vEjaΒtSr%o`]u"?޸* UOU~创wPFbH<gG8l{ɚU~$:a%By}者hTl^.͗>%͇;RD]qtJRX1^pJ-'{X[cC+?֠" /Z};oO$DҮ!'j*~`9+'}J)n(NJ)M?Nc4j`{yYׁٛ{5ScA3]bXAk=?5Hn3mG96_bιcQٟu `\ۯ U{ؒ70KٌClI_I9*z<َ .>*$}u[nD{_V."UƯ|EEŴ?Cfq9Z'{7pi=ʀђz2ƀ> n}s) ^&MB|cǡȾn*=,nR oZ$J<`sEN#r*Td`%yo&!QNJ*>ټGVo>S#cw4hqD9i].!vDY1?yOlUGDvs#xFq gLnYAU_|Eu}_߳UQV@E^s:( l얂Id~pyk<\ݐhGC<ܝavm7dJ:/`=c<gJDb}>l!}oF$2ń5`_Ao,&S^?t@;8xx῍p4tOFB΂(t΄b PW>\>ad'<&oJp\ e_֥۰<^+3nxͼ%A* v  k:/ /i"P <^/;ý &y}+`r/`l{l<\44b^8xp>J`4]_ Sd/'wܝw [|ƓT迦p-x~t3|[N 炮phT]<?&0M Lϳ~e5.Tw dfa\[[Q̼_8Y_[scHav_#ٷ5U[q`M`p8 :.|Pg ?88ncǸR0ix?zBiٝbWY]vz>YLDP &MTu1y.ba`y7Z411n/lI[Mo] kC ~Zq-/̵e*)s"+9 *xjbKmf3Xs3.Ę9SE;~ Wd6-To<??$bb%np:cB>fF[X-$ ߳ ;ZCM8@yq1(:Tu^p$*5_9Snݤarn.1R,be@̧C=yХ`60#0gs-'rQl?l{PL;LJ(+ @s;͟53=NR@{r,]}-!(t)10tk8'T"eϘ"V-<_I=3#K1EGLrǝq؞+~.< <'})" xp&<\]zh>\vc0zpxwbban0g>.1Gu=(@E ޯv lYz J-6 ^>S/}xk)6e6Ifj1򟏅S|C"l qU-zm*G)o7j^'Mbn!{t"F2ZxΈuXD}@#Gi?j-͗WюG)O`!}63 _n5/4S^_k-omʹX]տye;xa#[RI=/8s kbnN64x┫ozc v)`{.|M6_\EX<,IvV&q!Sh_QoY=UGpw*KnP+s:# ol[4ya[zyfY [G)*cvHSg"׻ȔyzS6)ffUY#uW<75{ulOw&`?;˔9|=7=գm4(瞃bu=zC-\M&,@[6EHstm14Oy58x.>Qt}Ď:O /}a |Mt?*6u4S4&`d[QS6^ϒ1-zptHlDǦށ%E}_|*ZcdZٛ^!~e?%IxHH%Mt}T\Xy:o\Hd-߷Zo?mm+,&ζ|7>݉KNRwVmɛkgy{2+MHԱ'ie i/ 1 &u6v$h77Ѿ}Ɇqʟieľ:i{8L}DݑMl}6![f󎎵Z/;' y[ =, 4g̼~վ|c ʹvD|TQaPk5k_Ǔu+Vr*Fg&o^ާGd^3ʳʧjӘ"zQL,iVUE8ޯ3 @jC7~R"-`<^yNY3aV›CMPry. >'Jj=𯈞/ Go<>&0pnp洈piZbDzzin:KɶFͭyC6g C~ly9wezáb";qt ,nUY@7їx)Y_o)3Me4_78Tը9}T7!ܰ%:ȣ7jNw蚰օHº^|;bBDwzüUse`w - ?|RyE yOɴt'\j@1=xGJZVsco\ uJ "DZ8\ C+{OzFu p5}3Kncxq 1W= !"4{A 9}AyqaYlD'M] jfd c+`(8 i=f WWD,I>?x8!"0Wƒ@:/HoD1;1&[1J?!T$_0k'juSQ~F<7k8ރYmpx߱i'zH]j0fHmd95n-Uxx*(U`L>?*3+1rߜũ}E<焿~/$:[)ɋpiọ?~w͎_tV>^F?3|bر ؃n/.qn8q=I+@+g}Dž<‘mk9͙Wr/@GX{:1 ̸̰*C ])F㇬B҇R7}RA'6U^`mT Yj)0pr t^_Q``ԿW,Xo~x 穷*] pM~41>gQc</oC*ǃT=oXY m;v,Ws{ƒUᕘdza5/f>LV9DŽ^Ip`.qhЇ6Pu 8Ƚ1t.>ZmĎ#z[Pr=ɇ2sIϘ ,OOk|eq~nf<:~"ƾJ0>X*sכٝnX95X,3/Γ95mO{==CBV`Y Vw'/휗Fর,,wxeq$xpP"tEr V;Ðt6]jgXߴ0>E}Xꤏ #0Bs*S;^pGD#N}5n?p_y8p(@yͧ?ýyLw p,']=kݹ(|70L~9\* gREn$KzTuWF^7Q'n`Yc'F p?yT`+X&3\jEy]'03tOidZv;xM/۞`]>7-*^}*^DHb½i@coA޵gO*6`]u/>tzM!nNN}b4^g>v[xV^~q+c;Rs?Q )qi7M y~*J}B,TL^Tbup]%l3"1鉶GKh'hDv=HrѵnE[ٍ/;ԭ%T$g`=bhnѶ%,1c}q74J=%oE"em#X _R9ӯơl\eV{k?:s˙:wn\߰|ĘnU53K]yO%}⎔ʃI)qx#GuDk8kY"Zâ@[-~>:a WHLA<|n>J{&_ !vy=(ٿ;A̮AU tTPPHa)CVK5͚b?O v6&<#nᐆ1W;G<+SD"٣ƭɧ Jy]h3\]wE͊u=?z:Ch^y!F$~2:lvQ縲oџlдq;<8^Egٽ#߱f~vGԨr7)a~{_sYޭ:Q"kl|o]>KT8V&+7$xkaoJɶIOtJzcސFJŃWOgexp2؋R.樿~7FZ2+Ys:?r?OQDi<-X}%/G0>M64{x:<"MѽTA"^O#m_M м'ޥA_Ӌ+u*BhQZIjZqGVi=% R12{#,^PN/t\><6Dv!qՐ?@]6}A_%["/*YΕXD7߈u$>y.CѢb/^F >X, }iGVhzYe(ɢ {;G"b SzI^qq| u"ـ '=gQ6 Ç2fIm{ SgRA\b){Ƽ &w |gNpμ{Kl pgW:eQ%CRt'z1wu$x5ED{Q*Y|NO$/#=gBdb*dG(T7zG6.'=!,PNlG+@$)Jxqȴ~P_]N7 ]ʃ~h,e"υ~Zߥs[?;b$WCwQPU-n7q2˿U5Mg~_ڳl5co1MbgT lqyBhY` FSOA*,TA}p]JvKGK6Cli%v.Zm}BϪLOF@C(p#< ϿdbrY3]̿fDf:WxR1Í4L(qsĩ N:~V>#V#˘mubB08ֹk75.e3&銱0D?eڧk=amx$!{*x.o8쫷DzOcO/Z3tDX[v{= E!܏%/axZ$?mOEqS;vEF2\f`;2 ya?g3TUC2rwD@ w%A("%UţU.ng}wc,aL*B`v~-u]h- GLoǛ& %,עg m/r^ux ,prT'&}Lor q|!Ư'nrW_U?zq:<p\}Kp + \s7{D~+ocZ*[_ 0fw -q;?;5qSR#x gM90PvlE(i xo/B[t7/ni<]q{.|ɱss>yg.`=!&.)d>Vjz*c^ רz^;k:/NvY .micwFw9CC"f=$<X@Nc~Dw], ?np^!Mp}<\G_2S׶j<zNo8ĭNz|9;׳ <}Z9 ~i^D"]jhg5' 8NOD_Pe, gԂs݇ Ï(XH4lx8^,nzʞ n}۾Z>.u?<(,Ί#u>| @<>7ykh@u˙2ܹQ{nv9;3 :aFԋDq,81:HTDоz~+OG޿Qw؎ǟ=cy$ im̧qNz6TlᏇC!+qW6{EsOڅעnk6>$m=Rt^~h 1Ѯ9b\&$hH$b'Wq>sT1ÇW0bot͛kt[޻cn [xExӫkGjG7e\mg/ICn,)" ϟ|JljOw =:dxV‡dJwvLUxKH)g{d{07a"lk9ZY%yp?=&yL}㸙+W{7UEuCwP4P!04ETv4ϏL#Й9R?3X O s9'ݴmW(.;9a'Y؈n%z=c=-SDOLRQt9 ϣؐQ֬?竵[ٽګ1{(n[GTecX`E{VbV;N-u6#ϤNy 4s:n܍\;;]:ce 3N|wWĤ%u*&s$h//گm;>{^ǃ`D)$ĉO0 Yȿ8Q_# Ol8QxЇ{ٻjٹ׽/PQݛ~2&#mGjV0v{qZO)] ~*_+l]p?Y4}!x Vo&| ,&3@B|z3x)32_e7?B&>tl1~†M]CU^,x0K|xc]Nϖ)8Kt+}$_~)4J/1fNe ^nGVgHT$KqI⨞\L"S`SMbM U8tPttWCuvd+.,N٫C7\SkdY*px7׈^sn#jHR& ;O{`i6[{g/0}ʖa|x+V79͉xJTIߚ'9ěGyV M@ K Kwޗ[tb|gKˏsRwd)jfv*m|D'gz{뚾~ޡy gq"˿Z%Ymb)*+k*ya Yyk>:w~{%IK~x6 "Ҭ^y5b41COJI4~In#ub3FH)tK0khS ky/p^jSt_oC7A\Aioe~'U$;=t`۳<|d b/Fjr+Qd1ko";ϊI)ilGd} f`orW1熬/v0x֒G. ڟ6({q@]i+Ga.1F|/vf~*͵^X߱兰|I8cdN#B,;=;lFΎj^Lip qV-R4Tpq"J^#@CJ?o!||~݀I0s&y#@7J(Ng8Vf.2q6)g^+KϿKkm NµPn)cڛ$ܵ<5`]}0{6/MOyeAK]xh@|ڡ(߀y2Z>Vy c{heXԆ `o>CGwrz`V6cNXW(ӯ+8bRm*\As.)jiPcTkxovUE.Bp4 sVlxՠh0s,Ds_(J_h.KÞD?P$AЂgs]kb~8ng"zDA p@v V{sϓh.I|q w6<ށ(?_2sQ- CWER)p81MD]3x՘! h³>㊟3{e'Gq^<(c8nDkM½Tze*bGO58gc(< " V HݟȎ7%W_x ZXR=j6ҩHw;z8!??|G/>.-<,DwW{L׿2f,m[o^YEyW +]A;[9 , 1;N7v2Ń͌'5)zH9ښ~^878h<ócY2{z'9u=Jdʝxvp0zxɽw|',&C2gF&w<9Og+n뻛[C/1ft9sױ˩P`>)><̚d4z?aBP߀[&Y=u\O{VQWLԉOTC*0;AթyW?zã]#V'WÜEYf9|Zk'2\'fyU&AO IߔQ0vBI D*]AP9#^Pss`OЯ\1o R ?2hz3|PZz)ҁkD"unwMٻQ{MPN^2ؔ'jg>&7QZ;Ocv|_ʊ(ۿֻÃx< +ڽRk1xSN4V9CKZmx%\GSqWϷ\Sktse Ϲ7mtܮYF7(Ms&)ToJ$R4g8E}„E"EigGgP.e*&gY|XKYoBEyxyR`,Na~X~c;[,vl_.%H3OZqē"ԫΎ?Snfokgmwuj47#mЏHqe?-~[ e}2d{Sk ÐBhEkPdOH__jʿ<贂op\|ӜZ+D0yANFK%=szKy,[taq?mؚ{-QZ̯ ; IwfnwO_4a~H\u2mw1$[ÛrW{Q>ԃ;pVם؂йZeml{Vl&WY['-ko|ݤVp5M,OP_K=Xrb\Zmu77J*6Z(i^}٥+n`YRT_Z<̇[&~ƞm,/ bIlC ,9 H𢡄&XJN2E#2l# [-dvb*.l:rWº]Եp9`jwHi=-eqT7oBObhgw1*K `X4B??\H=+J~2qza_oc} kg4)O/kzayrۨ^$芺:E4@&M/@?!;moԂCmyehu*|>u}],j b o(w+ EǎP6څ' }X-%Q-Xv9 [yV_3(,˵Z_>21&K$5d`OCoaBVrs/s-,̱Ġy5p2ywd+y> ¬cS.Gq݋ԗsZ,\{,(oQsX &.J\Nv25sg/̋J|=S{۾Rxn~}|[,oر(oVw'tI~|vn决^;sEЫJ vfTҗISn8YܺIZD(&I`6@Q(f/}(NL⭽Xqc:g%ɲlkcIcy;nHMwh-~vYuX2֛K/-h p`'=&AH| M#dʿ|d%7?wA C |\&‘/;4ZIq/B ӹ;. h0[ aN/p7|PH{{%ieL6sf ;ȥtx%Xr>/\vyԭp'K`2>riPQh3v?2XR2Ol?TO`xImJF~csKK݊V6=SMs`(8ZzW150u?< a0_3'6Xp.3b.I,za:q!}y1g ,^_YZX۹>}P3l?+ܬ ~X=+E9Ӕ?IޓqWwy*7$Zy*k _,-\󔏰HB7XYzk{SaFnWBӎ[|qW=z:Knm6lޫ0$`K/,dr-(snܴRy"ErO[LU h1 ʇs#Q5̩ st[z1(x7osM!2`ʪPdT;?@׸a RГ73^׹{|Ct|W\<yAot#]3(c~*|{q!e>ŻᜮB?wq5γs3xFQg.[s^ٽr];4+'ISyztj.F,~2xM3(y Ho%{OlY.Pວ; vp(0XPO/XزX@}0vp- m G-VLJo߾K2}@iXQ-;Ʌ29[WrhǸֲ` ïʥ7̕x{SgdFi&P|g$ʡF T2BWg#pZ "oMB}oFnvb$iֲSnc|mBN~Jfh}drZh&TbA48XQd% m(Nzg ɍ7xd e9s&t*υjSampmu*%ćc}s4f ^k.ܘ;*fOlFQ`МO~8K>sH~x#G JmL YS8%Yn dlNzҋ[k e_/[IQiR7/U)'a2EIq53ZTg%)RuȠy ?뾍uO3Zhq}њ;ַ GX%[y#- R~+4Њ3,hH{8JH:ӂޟ1> S&X<+UPNY7w26F-iѫJNd2z3"k]9TC< ݦ0·:<ZlY3҇4°N 䬼Jq.v2h3keA/ֹyeQ VMYoן71ԛRq;_Bg!{fInw)OrjGV:f~Ϲ}7YV8GZ*;ѲZڴkmq~ 3SBokC?㾯zH;ߏh=BYpՑ+p~ -rF߇Z>E;XޡD%lG(v4轃3˼QH} tt%cfem.PuțěDT)0&,j%Vrt󜅰5ڟq;'UPUē=sǔ#dsȏUb~xP~%}T|b!Z=Rƈsg @yJn32Rs!ɦ.L݈Ӕzd;V!OdPo_f:!qZ"7zVg%M=K!?!?|/fE=tNQĚ90Ӽ_ J\mFJ$O 5OD)'&I2XE Ig&OBXr-g' yV*' f ɻ".xE<rN ;I.9=6dAj(TAnȿ*a 2I1Hy"oaڞIl_wr^G뙱,0ʠ^[M+;,cvܬ7fDZ~F]yX/ e䵔c~J\vQ<vBFRvڎK W1H<ۇ)tc:|~&Z>\M?q7j_[E'JuY9tUQg+։rywuLK{F4KR*8A\z!˺=oY~T^GjWF,/56 'SH'A֪&Z-̥br1:ԑt8彖4M$fe[:=Jbh^++ǁIMuuwZ>@htևl /2ٳXH_uilK O+/ c}N&0V1g0>K[>#f?O%a7ۮU OT1FNfEpRHbbʌ*9@<86aeb(^^D' ;aXnP c>w#axD1[ˌR8XU$1_kYMv޴gNfmWs0{CKwi; pL+(G4 C1n^֠ͨ 8J`.vL!LN- _9.6xs-{O~k}WÏLg{?WYl4vYoM|&6qxr]v+1xǽ(p3E0 z`, =`#{N :2 :&KM'臼:sS.G4CW6pkf/J脑0X[YooGk+C&9 n:<8'89ƍrnF̯_SNͳ̾;[aH/ /!D d a@OHIΆBJ0| 0x {NZDX<`Zq"Da{hE0^|Acyn?A2]_ghz4qmE!vh*mHi(7Gۆ1T4:/zQ_5) o7̛Vpz /`NgPz ZoJuxXa iY {&epk럨.Nq9rv6ݐ)\Kb$8ԴSlrj MM\a`Ǿ~m0u[,їบ*.~E6|;2wޡw@kc%u ^vT%6Adw(s&FQ4~u+iܪ_^L'Y,0cx9P'9wC؊ljBag~گ@o@[뉑gXE'!Yw0G+~ s-|RPkWݟI8*9!G ʙWx͂ÑO(|7`q촆 T_IR{%VVGu&1J;xNp.Er /7b p<G鏖-Zhjq U } ѧ?A{V{12Z?pˇ;GriGq$>/`16Y^闻̏\. y҂X\51 `8z3ޡqN`}hVZfSCf}1{ Wv +{k=[rVB*8VGhx~ [M;fp[^4dvyַt1<,dā R?clsgQjq11.ƽ(3 #^8VA~gX Խy*NbGJIGHW̛@yX偣}ԲO0^4B;4O*M&@)h5lpΈ:탈bwrqݸ1?O:ՠ[0\*&y_cy_xORgv*^5~Nrg-孈o[L59SM>9ñuJyQʸ?A{a9,p(=F6x73D/8oFbm-!rgy<clg󘽂kq< \u>ו͝n[HMp+өu{&cavڱ}rx^ _8dmۤbǞu/9w: 9`\|u\?ǽ##ϙ~8'V`reVg *2YhyYSU7VPܚd)ߵ^9430li,:\70FV ~!,;ӧ4>)P@YbΩM^ĽjY0n2zCK DWt!S"zY'/st"1񓅳(:} ''Y9*VSO߀!M>:Tu:m&t V'͎/n̍\o=79lSý52e<-4C}&LșI!Nٲ.tB,?hs k&Tok=?CDR=1RSrz+0Cnt8upZ~;8\)/1;k&ewsְ(Sxk̪^=Vr%=Hw?29#zږe˨#w/}$ŪLoRe|7b,94p Y2㥁yt"|2Eqr #UsYZPmR(ug[zkYUkX3/%)/WPVՐoG]tsu#gg;:k>}w/8mk%'3TʖB/"޷N^zRFyH+& ~pPeEBe=r'dX^:ĻR&[zr7y4ޞ'}dŞArc7;&S]\MyuD@I caQOP—J Р FN\Ӗ!uУl{j4,@:Q3&˔i${)N-Q @ ຸ,1i>ZIc͉L0d׹ۦ(|XKT5Mj|0ɩߞu(Opsg .^΋Yd|\a'?M\0!p<)~mҦo;2PS}=9ș _GO"9pvѷ[3@?\sˬz3z=7_AP Fsfim#`YaGϲ+gs$[5Y6W``d6oN7oۊJ\h"٢:P.Kh)u8!'D5O,e;w/Ε+]X/`0\Ѽl1V\zbkr~/3[]#+,ߔcYR{0<֨YvFǴXzz\90Pu綁\l.`(%]S_ ?N C `Wmܑ10S+4=+-{L!<3{ǦեywE篗X 8EM_;|T+疁PW㚧B=Xq#35ށpjv ƻJpl2q@OGwLPp >oò3!ai=@ 8\{5`;iϿj&TNX{onk9". E0i9ե7&ry0|49ZJ G0X|Q/81G+#F!֡8HsV9> l 5sA&0{R`%<Z|1vlbP^oQ.(S,~ qJ`3צ Z?phe(|7ۭ cى8/MY #!©CQc׀RXOZD?8'%!a^Wu>X0kN_;#l?wKHc H -(`t7 "*X؊ݭc}ykf-gohLuh> ΉNEC=TC43-$tmvք&@gȥ݅t+@7 ሓ!?J^C^M暤^s849|:ss }7H>H޿Ic1 L V˖?#yPKˍ^+Q+JmEjUJ+`D@'#KDw!h2 t_%@.u gD6³Gp2;_ aCWr;pRpρeEP/ \T,[&º}u>jͥ-2%HEDKOKhw!!-0ed_}Dg-rXD'"}1r r@&4.}۟<;$u-ԅQNC$ؔ)RsK k!OսQHLp>@B|5Ƨ]BT0aߍ^s5zϩ,.- i]BQoS9[>y O!ڃ\2ىODY ;6A{0F+^%$Q u(Q@*hI}eŇ0&.\+SmH|8U,l2cAD6wm+try,QH8 L'%zw_Kc)/w<Kz8I48Fqgk -ދ t}Cz:SD.œL0,`=(]LRw*rDQ[.4 Y9 r`GAxo,;d n/D| |w\=9(ND7_v$r=r"mIuza\jTj0[bWQrVe7Ds3a/32 O&+>GеޟFL]Oa#c{?a>H`E2P׃Fr1}pw|ȩ\nLSks'q?S ^/5󏌕q]-VG@!{C@ds⁠P+P~p)xl3 ~gN9sDZWA}#}{;4]ZNp>7j SuFu<<6]7[sfO4rݰVvT~w+ϻiR޸r__(=>}ɐ"Ƙ|csnS`PWEE@9~!G;"G}nof:h䨯g\r zb($Ы4_~boa}d{ R O}[N]'snP.Oys\6yE JЇ1;n!v #fx]{pKBӈ6#ΛGnQÿ(ݳ)fwLʱ#b~n%k~ Ê߆=R(m &5OjΝ zSvOU<E:EՏw1F @NI i:[M}߫s>gm8i5VSΖ1rq x+;'@0+LZ:p/pwlֶyUv%~\[k5vmQGB1U܏Uwz׿ӊ_{%E&uﮒ5Ђ8!OTIV*'~+"I=p\Vo~s_k] ҢT3ij(ֿ/*,֟tdI6r=G4eIQؤS7ڷ uL֔yn(э _Qȷvo>(U%CSܬ-]*&%s}>VOVo||W 86%ˬެEɖ7_Otes|ԓf6Zܷͦěe[$W[Υ1[vqg$E[<'92bOĝ#Zモcem/҅qyӥҋLJ~̂*LAKdƽ?O$mwrύB}[ڑxT[9"B]$pĽSю;qy`ۃB$o{^g!i?HnX m9oui D yd[Z\`(ЗDXOM(]-*!ޒ!p Ak)}$JP |"/R~%DFDR畅}{z3; ,-ޕ>RȤ3v;z+Z@gI|vO>ڷh>}c0`s$R#۝ӄ|vq xGȳ48?TBٔBwՂ N\/:䥿IiA.*/ 1j&nL٤}9JޝRj.?I6YH]:iNtyȪqQrGyLp#t&= ;r[23ژO݆71푏H;Sm?rH:Ь"5p=k<[`r8Jd ;62D#/:x ;e$}(_"?Ww/{"{!y @/]D]%w 7p[WD=?`!s y_s*]O}:`]S$_Cv?#jz $? ?ԝ')˘xb%usӇ~s%x+ ;xV0,6x9^Y2dE~ ~ n?dz 29 t> ݸ?=MǑÿ]B> %w+lT?grx9s˃DL@xlF߶Dnax 䜁l.s@'~{g FIOI^1<<룘iau-{'`Gt HnyJ \¹LOk`k$خC]輅 zNB ^@wyBD BOC׎'BG!N@{$wy>>\>;Џ-',+4dxcK/2#[s{ RpgՒ-AlA{"J?a Ch4(0i x:?Cz|x@5{lnvδžÆZB1-Бזn7uս_2d<ς i]{:,  s%{rՅa1ڌ}#i>Mz! 9B`vs,2>hй_)xYn{N zз~EW}j q;Psa~x;b:[jf>~Ԯ1r uvЂd7CB^6t|7rAXLcC"B\`{qFtNU!M%`U7R|%>Ww}grI!w߯=ržDGλw{ 羗]qVoɃz(3'^-piaxW#q)l zf[ "r˕9^4h߄: J("bnzxl>%wIƦ@ζKU3owz>A-c03eRQZH>xXMySMU2TP4V* xFMjswWzլ"~Թz duBuSؖ8rlOT2(GWy J\N0畒uTG_>y2mr~sƈ4'fǖ|Sy^T+3̧¦njP_$ աa|vϥ|^~]4kܷ8kG"?33IH$ۿ:k`9~Cy)o.s*wOD?z *_=Ir$x Ĕ^*e#w>l_mUgpd̗S0)*yѲ2ٮw>Kb8mjW\eDem}uy/wV(^UCwHgA\i,Œ-|/ZlgYTɝ5ygſ۸\u0߫wMS؁b,dGNJFIe9ߟ|ڿi,ɒ`bv !-r~rKW* Jo`^;ָ'E 啘jrTc}[{b Y_N1e B\^,hLzZzd~Jtniٟ,A6|JwSy4K5\UṃST_)x bSuۺjwtoe{_?_]woظMr;]n8]. G)zxXɧ.Ҝ[~4)}k ]:tRs{:Cu>ҘMHno8~bcA/|ff|`I{>Krߦi|܆%\)nuMgRvpCZɠi]S,%ݧѱyft2߭d?n_^gw0jz4 oN OHg-3{-is ޻yP5qsX-NK$$)u*^i;R +㭃 +[7lQV9bk>bsU+Ջ;\ֲ\q2M@'WwT4w)9jf R٪>L<~+۴f|BqgjۀxmL6cٔsڦ)U,;Hw yhWb]_p)k ^ ?Fg$v O W0v"'Bǿx4p;1wN`wG/.}y*<ijsȃ` O{]5Dt h=p8[;~wC-܈!o 'a/"7ޟE{<0*rktk; 'a鄴@u*xrKAbXB0>A|_"u{<< } ^\G<y_X! OP*sf?v >n1rșܓC+C@~u`'! >/r ^NKa-ZGBF­L+AA/\W AxW+d xpj$oGy2x mv߷ABb*K:t_IUMgiuE &t. w3o~h>*{CW;HсX~i|@d2DDz^#ܒ=o[ ͘|9#Ka?'BGkP]yAgtͨWY*2"w˒z" C~GN@=FȓH[@'_K3@/{A/B'#"} 6*mnw:`KAHqBs+>:[ 7bn>ԐN!:ac> +ȢJ%J;^`NdM:dLguwj#Z`>Z-rݹY\N wL]m<] XYhx!c'ot |Q#FCJ +ž{' , SR{"oځ-6hy %N\mf,R?E(\ yJd= C`KGg1M 3{GБb%hj Qs#/,)/.h802[fvhy=c8 ^miC#W1h8eiA/5._'JިcAg?}QŰs0DwC9Н(tU% r V`אQOO|#*{?AA$+CuEޒ>NwλpRrq$K))4'Vx%FuOOPp;X y7ayם`u?h3|'2 r͐+ƶhl`Yw}:\w}T/E2(iA|9.,ϛiOCIV:~gL#!B|7Um-F.X[0:'COOO_`~"+'ЋmnO 14#!Z5@ Hc?B^<. )asFEd73@,<^,a #*— |uY9T~1hä*m%zI/_9b/9&2?yԮ|boˏyE ^gMXI(uG{HcɘOBw"V3ه;O؏sp>ozSUFn'FyV|nϳhFJ_ռkzAvwf2UW [Zר/Y%'6voeZPo]u51ޜV{ԻP݃FJ1[}C'oN!dvS*ICA[EoJsR௞\4?Hg{sl4o`2?]"pYHCTo!2}>;L+x\@Nܩ |~z3.ծt?-d]u$䢚kW/nqֹhLjǹɹ=M6c }mq 0>I!`,wsҹ2J)Kr#m&dᛈ23:#Kk p5vu`OU!\1:+K?4z4uZ!m 0YdJ\OH9`*;Esjʙs>1g%r׬7n(EX|rW<뒁sڒ}>yMruy/MM.Mx)->eidFg2eeɩ~ ̡&|O@pF+e ar.畗)\?ɛ7wg}-ʞ>ܖ ~: Khv7#\/.}rhfOvKeȣe1wg8D\^ЗH$ɽ1&i|l%\{ʣIα<ʔ޲F.S@=G RY-yٗ17VߟɕOsGjJ֗Y*ܑG\Wj̇KI+؏,YWRS3 sh*R.~E\뿸1#ÞV{n>z^@LU WȪ \gƫj`>zdV8֐1\SvT^۱5kֻΧU8XԞU932)oʝKڤZ[Id=|J fWqI9k]2n'.T{d(Mv_TU =-5S(_x"1V+FhGu|rSRVU'dž%2Ζ5jL@l%Ĭ&ry m^ő;ye|6Ώ]cJ9BxEwGF-!6D W+BmѾ)g?% ]| B1 䒛`{]a@sПuNKnolNt] WEiM?PT 4U5>r;˝,g ȣO"}&6AF" k#~ {7_ ވw!g"9"=IϺ-ٷM=#hh4HqvozE瓕Sŗ Y|'5&qت !rdı㶂dбNj;Dܻ [hER\\2C6COtp(ǰ@_zhUwⱙ}h69GDP;ÞN@gwƴÈ ­9fзݰ᰹vm l|ubD6N$tDʼnxn# ]l 1mCZ vZ^l_܁ׁw2_*{>~dx`[ Gw&E t[ QOw׎ uW%t]oFD5!o-AtҀArK89>k[̐:\w>^ Be;8_*|=E*\>#εKp(ff-B7'̼_B߰C/]zȆՀUZ1ޠN+CG!T!S@tO'ϝ*X$8]'aëeǼnR|܃@!LS'O#78svk~n YM w7V棑n3eᓤ-u}%9VEUH?]ܿ3+O!-?y}Zww-{yloJ=Z=j \H8; A~% 5F-mrqL.P6w!y~ce і^![}uӕ )./t9D+/1EP=r)auE;nqǜ4&?.8tו|w _z+q2ι8AjṃIK>FP_vG@5J^Ks_V')|k HFlW) -~:?_; S x&ԯ{H1ܺm\X)#*L_ d^[Jr)Ȥ-TFHNy\x=)sNkggFO=AN§dːHW)B$<5:vb\GL[ɝTə J2w0fmފ]\z yo3q$~ڂNdOgdyYluy\w4WXմށܵ"UDWPR\I;c*}Z}?G%+:k'&?m4%E썢^DІXNZ1v$r5}H~yd* ;+r%gnd;rem9bȭy3ؾ< g (]'RV0w6ҳ[y]q82R3N^Z)d֩։vI최V2/(4_Kʄ"`Uԩ JeP\/ ΑQIgIk,K17xR|c_mC3W6+B"G|U4soi #d+ ]UpbmvA5iz` #&*Ffo?VV'FсMP1 TTy0>5U縤v>k5cXMf{:-"ƅz87#OƭaZg8PgMx468 ܾ ]:k]E>;xr2 y%煿Y nB0A3b /<2"ic]AC;auŌ+9?^ׯnkApm7k@x#~ nV9hu*dOrw^ڊ~|[:=< _9y!g|dMx­2QsKBnD#/)n-sh Pi0 ᓝtໞ{S;|bi ]ol`7[A fZyqV 'wm~6a]7iDuk6D4 l8?L^?Nx MDGF(5a9W] 7q;<zچ1: 94 @Ͱd;icsiO%(] [׀yཱུh-dzfj(B*Wh qMiJA^SEKeAr9|,dD @oپ'DFbMճ`3t@ Uk@B->걤l.NpHz)0 ~ s|3UX] Oc%Nt' +Dp-Lt*A[kЇ-.3$i׃.:sL>U_(^j L@}!rٝХ"^4OE/X :~cOwip)-!fMUIoHTI~Mznͥ}E)z=tHX[z$g!G+ q[3cOz&f`d l6ڠzsX\JЁºϋI_l]Zg:eO4)VpECW1D7^4zҗQ$7g-p>bĿ_1ԋ`/}犧 U* Y)I< yxu|;|Dʩ})c6㬬We p3gN't1Ȇdsr5WPGӇXOK s}٤LSyDE[Iޮ/AvSXof8]7R߬~c<?' ,ro]Wra97ݹK+)6!(/?>-dd G'O٨NCE{f~WROl`Bg~fϵzrWN2K%B*P҃<np+wIp@"xfxA>iA=RB&q3x 3L)5fsA{Q9 uZ/'Lޒa{H:^<"XQ8s^:iq>(,Z>3c<Ҹ.[;*9_Ȕ\2'yW!s 6_q3EWr;I̩p1wIЇìI岷JƲW7v*f$M7fӳl/+fpXpηE|9O)e\OMc>d|,K3݉˟rJra⯙\(-#Yy4}h9wݙz)Ꟊed+?Ѕ| 7t)1\mzhƫěIaIR4l+3p(n#kJn۶س $*qF(W췝S)2lz mi%$I_T-(ӐvIρK D cJh4wbWspb?e>]YM\P\B~xj|$.*_E~]ʸ5}B4sĊMdF.$W|]M$s[F% ;&:U5rԌy\jt;`羞Jj>&s%suZSTn\6[+bkX*E0psa֐D'Jjff苩ݪ[)YQ Sm**BCk;QF@}u`Aa~NQ_Ƌ_p}&#Mv;LlyE`YR1/N>duw6agnǰaG/.#UFƍ|6gT}"s.:pT{/8wqcl.b%.]=\s+vƸ1yz/5>fk ./mޫ|d||>ޟ0q?]M'MҚT6Yurf( )M4((TLkn0"X98{hF38+l֋ٳgߟ01sͳ8_w~QTH|ȧw.8p¶aUiEDDX4kѽ,Zrj҃#wF ڲl FEW)U-S_"/^>>'A.!{DČ$qRz(95wJJi:i҇q+sn槬l}O*P.)4-WVtxnRҵ(s/z/͕WB^STݯzw͘k}U 7^wa\õ3ֿmn!gSFݍ 65n٢yGmˁ-jj5p냶9mo=r1;LkWJ={=Z{jݻa龶}?<qytm><#<>ߝ945:~'#Ns*3vgN>{sϻ» {Qb%K;/;\>}eWC~w7nԺV[ͷ-o3N]Mw/?0῏2+<.yd~O۟y>{<ꋍ/_^{Z7Qo=nQa~}je_7oF>Ww~;ʿO7tQd+ ėlJJ_)y%,[#\X>X~B X+%ve}k_ݪTUߨMPûEu=}z^ո9AT!ut&I+R[w^>}_Qqxd_45 1;jc"9ږVVC4i]fnjh%ʶenGvvF$=2}<{R *G}' }]F_rrLԘ_cs]T\Vjָmp7u:z;G?5뤷g_+ &T7ӤI'O|Wi@}f`~)QSj7y޴i/8803 hYfϛr9N{~y[o 1 Y#4;炥 ^, Zx1llpu,cwLM/iYeռl]}*3Jgq⾭HEJOذ|ቇ&MI25qjxuf2]3fzONfJnU^|#W ,ZR8DԠyͪCeneWO]|Q9UCZszAkSkek zU߰t][Mþ;6Lpirӵ7^fϷLoߖVփ['o}ߖM[~70ݱu]whwhomqU{oɾW3:wݿف8Ó_;p࣏;u:vO=Y|JT؞9xsvw8? .8K]v|+G:_=vC0QwSf-[{;θ{߽.?{æG}U=VDIO?߳g>~狘^Ƽ*Տ+_&m;wUޗGM}i觎ώqr넯7o }+;}ڿ:dkNEbuqTt?o2A2{ed^"W,AK~B)E#BJ.++oVPIQy:EZKՇ?1ZㄦyZ,^H?Wzo}d/0T3\O7_:2SæMJ4aμbŗ:Y2y3H6C mmrXpHgdy2^K:?s1;z2<7nܾǺ3.C5^~|*/ Jo=Z} d'MK&4gɓ&w?0458v攬)-?lgPSaۭAiҋ bAEDDDHGD4BBB {jA *~3g3sϚ'{kMf?+Wͮ aAA3W];m4lHSC-BKŒxo7nܿ~s LT[%1brbc%q*-N$>s{07q&)6i%jڔv6m"z7 ۀ g!P#U <>HF"q( m.tb]c8_|0-!0OL%%! d E£R hiUt+zÁ1d>d^#؟32V9D.Wi)~$ YnU9[syyybQQRAqeQBDY)J*R^įnKiWɲr nF%r*jbPͩZZnrn>asCcFAji9YoHCkKE[IQ;C3SWpDkwgeOIaoFߦ>x[3F 6 uq+#1#ӣG{X)pz{ot_ ׉IɮGZO=>Ɂ'EOw?=3|&|9 ƴ4K̆+૥7roo;9Sgf_M}&-k? [m~XںTyڤt!& ?1MfATq[bbł;n4z)TTVڶ=efi4$BVx6,^8G#bI5/oo!>$R)فOfю҆! Sϲd/?dq8Ang7d^8Sgg͎}~r׫_Y~˛WނBb?WђRŲ2nyq%de߅o|UO_k^k*yY{ˮ'7e6m$$ ТHQ *T;Բ5?ik9{s٭vlmy{=J;  0\ Jdzw=lݦ{]>~}ffI=|DĢw,X~8|l s\8ZZxD'ml&NEZgitӑtsY..a]wv]u[rgyE6yp>fg.>K|)W^605H1lq󐨐בj0Ӱp;#&#/G>r7?GE}N%{$%ؽ5q6q^$~cblԤ?ɰZTqt{[`pycH+ +D#29JF-A5 )xuui=[g')>89LMM</zmk_R{{:(iۿ;w}m8Oe??/̾rŜה3<5羻/#G߂b"{O۟zdDYz||fzFoC_ǫfkfXkYn]/5Hd=e66N(o.HxRqMwN]E]jZNGHCO:V_o*2mf~A=oGw\Sëv|an4+q׊1D[g`Ϯ=Ŧ {ms@J6b6~`ϡj?og<Ȋ|:r1cVV/ajD쉅'lTloo߮N3=g:89;:;88 9;9<[Exn9+u-m=}#c3WPW>!>3篝tUiK%?9W9zAAeT_~'Jǰ TZ$8rF7cIq3[tJ[jXAܮ#- /~-)=i=’&Enڞt& h ,`m0" B~@oBüaR!G_Qg !iL=VۊoB'01N'(g)l EIIdt1-,]ʎg7723gyAJ*BI;-W.#f޴O4,6p U х%IaR,yRW:^U[~U"NeeVƪتGjkjVԙog6lmn4i,i2ooinqiko}ӶԎPYe}Ǵ'WO4 Q// rj>,e#m;ǴwmGp`ăq߇+ G8SS{]I3Oy>{<̋__ffH4_e6x-~McoYkxoՇV>Y}|s/+k7o93 /(.`7,\kqҷhiL=̟GW?sW6~r]_eʎmܰ1SBnT>\~UA8Tc*/TjjU˚D-} m{!{G6o1%n }m/_~GQEd!qNF@_v}4ndt=TLgO_av> ?m|rz̙3zO9;t*t6t|qY?:[w$_KQdTlre5un^a1 Խ׳ld_xB?r@k`zpt(x0zDwdv+wގō-ESǾop-w=1m2#'VO:<,٫^7NS^n~=g'^׿9޷wu3?|1Og?5>9wV{7K엙s_O~f=i1=A?&zO,IW'K疚M9+[W^.aUeѿ[V6_*l2۴PP) 5ZZZI:&:1[my*MiivK>k  1ݹ{'W(4wg6]О&S'{~ؗom?YA>p sw#GD_Go}bfv1v+q Q/O=q򎍧)Swmm?yzɾ댍upX)Y9Y 9Թ5W[<7Uq\`d` B`k ^ )u=P0ذ#EFF"QuSfͩQYQk!]n!oqnG[ߖ`Ms>q{",mkREVrZ3)RcR蓮1/Ia; ҎC"> u@`Up x@L ͑${EWb1јa^,7C#0C'HHdC2Q%ږ"fy[7O(aEmncAGMa䘤pQiₒ]%RR`A?++>UެZ\R !jr5"t$'\k'ڞ;v4v^~5W/1ȓ2ėaΈȧQ;p{f>x;=2HQTҬ{i3^DOLΜJ72ߝGOj>g=(#~umh))ziyr ?=g^CۯK:B|~!^ i[Ч xt(gB?{`F. Ls5D:A: PQ)ۼр P!xғ[ʡihQ?N *@QD~b94`?|+9;f3ƒV,!DŽzp,rCYo P 'W)ݠP>s=h.yMdy0]6+γi\7A'n@qW!L '+^wxďti#ztPOd;`bV\A6잧2xĖ3xv0 N7n6^Du/GAU2TH$RМ}|+{rxD ^=6eER}uȂ,#FAmH}V3Ȼ|3^=Ο> (^{?%K CWOzCoZiN ^[9)QPdJ́Z_@o@=!t>{ KvS|l`o!? @IaDohYV.Gv/ ݛLUK=Mu .{v Kx )w 7S}Ᏻ~591 ^bFѩ=ۗQ3(>T@ j~{S}% :c hH06B('g^"فz ىmVDGT0>XCn/QcFQDr/q@\jA`#!Kc v4KM)O*/#^P)4ՀEW "r'!k܏Fqgy=ϐ ƝC*! " O{cpcGlR+4AJJ,geEpK*bs ?|_3أv},K0/f[hE#p"rW p/?.1s ȰpDVV6\dz=V3XM7;;Po-7;KJcdx­밇i7kayw/\5e2E qs vAx er#T@q2`nM4a!Wlas5v_y1J:pz>.?`a6O{ajYQǡ|.6Ɉ}Lj7/^ڃ`E!SOecQe C;NބIM!\7 .u;D҆#A܊]H>Y/x:N0[A]x;tj i7}=wžj-LٍyK*Gg(ۂ`l_B*` 7Bfau{OܹHzIiyB_Pp [m;J$an(`01ѤLH7!M.<`:1qn,*yF铏#ln ,s荄ӏI/w5㻳\`XuH}NF:v%: PC4"Hצo؀{q _hMBs$| :Q+'Q.){+C]HDL.jM* mp=Eܢ3(DPFE~ +N5&O!OF^ME.pG@v"p/`;}qk/a{~Fa֤kW[Z|V&ᅌ-j;!v;rq"d, (%;&1^V7N7ۏBa~%'U0ts4h6 %"e?ZI ׽sx(AŘC"%~2;nļ!#'Eɕ4rG1QO!*{  j{ux]VİɂҼy/!,H>H|ą$}B˯8_ lUVs xXMb WJy0$E-" 򒌈ڙ~lpF\+h+s2MoLkE?__JY[P@"*K4"@)\8$j,{,nDCM8zMi <)%\q"ax{6{ί8]!H!Bҟز`( !u#M[Li$Vk0ZD[ oMw> gvG`r0v0lX?4DsK,`;W譄_ |je%ܩȳ^X"?Lb27k"uCmbUA)GAxҶ3޻A.pN٫#} t b{k-{#<+Wh2Ah:#6\nq1!@`*:mӵ`'=gq`&gh,J(sWI2q aՑE k^‚}5BtR\`аh3#T tKrx ԇ'ɬZy8_Ib۱Ǩ8$ ŪпnR爪/9|_A #(⚰۪UEM~' 2*Ƈ~,E뼋D? !)Sz,<%LɄǂ[9yqy/"4q~+?7;Zu\I$&2 xfoiKEKB\x`q+ sc_S?d.SNH?!qӶ y)fqRr3H% j(!)˜!Ȗ'8څ0fV^;4(}iyF%zrgh) uQ:"*|p<ͺWWx&rP1{[.ˋ˜t R9JB"zM8cY]9˽[ޝI(Af)T:ňɷ=)IZ&nYYKuĽ;y{:*r °}^4B6@`oţ*d2@SP"(l' uK# "-Xfx&x:*uD:ty/Chv{=4DΞ9k-h/wg1 pPiqWA_ 7  S5Y|DYjUpuP&}PWBx[hE C>frPD\K*//Zī/pʚK\ȆLK3ł-E/3樷 YJUG`Z;rՊŹA6VȠXigIxY Z|d-7?'k2]ȏ{_e)Ǵ?v%!c` F!ÔQ aR_x7+/`ĿraylLp) s*?KZgDr=lى0%6xSFMĖ$% q$ Z(E+ٿ\\ݬʣw+Yw95YQDl-i[tDnQ^J~%68 ;Q\ ⵉ]qJE7&vFNr53vd5Dm/mHv_]IMz_AK\rIIe6rD/Y_!m⵾']rp\&8U<`ZUr1_mi }xYxi^[LVϗ=J?eS 0o :剀GֳAgvd7; ~|AC ?aLHm!4X zpL)ʾH_^|-oHiS+ktY< GO2 kpq;+X@B\f|WTǜ?( Jp@UMdX Uu\AŴVȐ J܉7 !t8c>\uXOUyp22L B.4S>Fw1}R͋iySItr>rʎM%[!| =!ûYۗUKw-}2)ќ eyǘ gn  2y,CV92󅴏U>yPS:Xzݙ{GVvWN^ ߖ@KFUZPEWiK>FşREK"lxa.r !5,;(\v6Xp22y gffek,*`)&y(*\͕_ɻ}P+Q's_Ɯ qwwZРWZ\!Y ;^Vf#\u^Qcrc YͤUFÑ?KO6_LZo^﫱îgvLC#`}Pb~S[Cݩ%6Z4"rUZR|:&l/&j3 4 Yˍc-!*]_^H@hOB*MCm7;sɖA$cTF;_Wl2Ȧ#s=@nڒU*#A#dΔv2T?C2ˬ'{=Ջz6j⿸}n ݵ8ܔU,BF6W`&b:z'j,ڔ*ztI~lě{H䓺VdwEVUFBЪ<28 zYسUef(ƿ!(۽[y4\=Lt RsSy|@SLNH5aeU )YiTq/_>cޔ[1E6Oۣ鐮,BS䆅5dŊbtr[Jsܓ Y6'DU7k[$_hJ@l C]jr^TdX^pr]HR"/[]2Ѯ6T_Ʊdٿ5Th->Tp.)ޒ+y ^`a p=ܡ8x1XgȎV_al|B94m j?)4)>qddd  FݎMizja/!ζU8$ҹ,ieV A:j/oWw4'InIw f_W:&^Ywb " z Jie74..6j0g bzfd`? )# *$LB^uʼnm:h '3II sCT!QcU\ĭ-ZKO*;}_V(u(%0-%d*k:) C0ҤeV"dHİې{/o\K'^:yC2Gë͗SN ={ھl4.1U=_Tpؽ1DIFS(J݉Y Vg*!O|H$^Vp3PNB;t%;{7B}@"a'G0o&tkCN p'XDZ|!xprϑ BdAuw@ 1 F%;׾EBU s4+ayY ̊Uۖ M)M2uroْzaMPVci &AS.q.IԚK?!:^0E֝n)iE]汎/KLP6m., 4M۴GEJ]R75)y۔.ήJۗ9[G28|F%_p<}Rʒ F}Zמy[2h^yiZ^%w=]ॿi% p63Vpi RMStCS)L=V^oJ,0]V n|όcP)+='|S;&YRHu?8Rkihc ]po=@uc` )~ήRďPXa*hAR ncbY=^qNI2*Lte_Ll9[DѪ|)"@J}w2 GQFAo]P@X5 ` HFLn AG`D 8bb2t6FZHsy1"_ q!"!ԑ &8RB ~>:AmBB,:@RCu< QMI"\ ] w?-Gg ?[6{0pgN=u~j]X^;,¡Q0#r\-8 Lxf#6Ӄ6#^rmmbZC+}lhw ^`fXϿQr^}: >AE DB .4/D$@ę7" OԐeo#1nbkv=5U=AB&@@f `AmYT Xx آW;!9~b"#n#:hop Rl0=:$c9 :^;a]m.rKHA? jq\Zn b w>pSzh yāqc|ɾONXFP]nQ[0 '0t(nX!F;UflAЈ=(*zZcxvI>d0s34}r?Z➖J'@xN"vZ"3Xq=ZM#Ae@%Š6#M M)K?>((FRP1(`cX:.,"&#|xb{+d!bܡX&ު( c\S;'sTA Js+ EBkdxPTH@\\Bn17\cwٜ p$2hDT6U6g%#O>^d0+|V$ 'fKO`Ͳf '=:-ZquQWߋP.&c̃s*G&O2•PmSԳDT`\a_E5=1IpQb_G``:Ǯtj Aݾ&2QV[C(ub rauIה`Js0dQ9QLMt3xԌNg,В҇)˸)mORE`a=O=,^PdC6>#S.aҽ2= x+'ynVobp-E8*C.3qьW0Y9WQZSj#ԩM~V֜T[XY`Ґv9܀@_&) }SQ),kZPLR)Fwvs-;/2=-t|v ND7q5̏JXN;)qz_BX]&+7UoÒJ?4`|% n<Ρ( 2fO8خGjI,Jϧy2q˰'C1/D:5`9|:OoL&I6Apo"IclLn {V7s1*&֯kP-)՞i\>Ǜ)^>R*p'͛Pp -,q7ߑZ5ˣ/rnPyp)cX{ך=A*l y I;PIusNeq4691ڱa6-`s5SpjqDIuKmWin 뀕To`^n e|5y2,/nJ"ڬQy /UR8 nIdэJ-vW[jWa>4g,b{3ܘ@dݏi yrS+420sk|1ՊFAm>Sr뢔x=ޗwT;PUƢ)L)]?Fkʙ[8+%1G6_ݘM}He-vSrӲT0b'!}W-e `V tC\|!5s83ag8 i Us{Qm&HȔp9LRZNY`c'i\,ׄ'.D^z>AM$s~Il6Yr3X$<& υ[@*; _oY$*6tgNHz@OQ%,H{/5͛޼嫄ysh^b/@*y%|aܤ}IKAՕȵ}ʜfE|G~,ύTmYXW#X#쾒?BX9v sqV!r椋0Db!Yq'[b +'jmUCiO89N120=ݻn > {j]r۾,zK񖙆5Ε5q dyeS42ή!N0/"4_lhi~PӰ7PfiJf+pR.ODH$_l9oCԣc>Z kUYӱV^^^Ss?_ł-U H27잔/ wkBePXQmDuGw\{hX^>f)_nᅶсRKdx!w%uv~ܵ]a}I셰ꙸFE܍I@o`:K[Jw}gɧrd̋\aR_#|2n|ABDvBdIî-y5࿭Bf@Rm/cOLM]&3+S=>?=Fmwu0e_< "*љ?wb/.pKI/luc3ӼS 1 w/N=S E:å'Z$I碧1^KYo~YuO-FF%;aZMѵNOu$eCRy}bOU#2 i4W󏡗(R!M≝z̏j:z uwkc@UKf*lbtq$Y(To"y@Y{a,ǽ6H1*`f*.ɷ.D OV^1 ^ SJq-nEs59Z0mJ1S~m:d/n>{ _]}(qrμbrHCّ֡ݝeAjM'0qZ#On_ t.Wy/|A:s';@Ka7|5 KPqBs551-6k1I5m\_v.b5mdj$x8Sݓ_޳2XP)*g"mv6V?nHI^3~N-"'89^|:a5 _ef|ʈLs=Lnyסo]y7"\!Z̡~vסuz#Ϩj;!䴏йpXc[շ)ZmAβfԖ\w|~tH0H{/:OG'I- ~-i=SEm/oVW6y  gԂx]k\W@:@ewpmii찷=29-bm9a5*Uu$q3n'-1h$^]!^h;a)NFqW8myZjV7SԮSt4WĶ% ;a:zjC-)i1]&֢֝~,z}J\1qu(7{7Az%^7d]I[%o\6EcTP]mBǍ_=H != @Ñc dDGDL)E-aPQ3I) z1x 돱:*@!BDQ`)r;)sO2b֑Ԓ;OKQhW3cYpp+3:?A?݂N;J.6"ZPhmփ?+!bH+G):s`WkWwDk# Ez$5FY,azaiޓZ@R7TJs4#6AF?Btڟ)SK(]9Ϫx]SսRif?OMOC_P5eI_ 鲨6D˂>DH|{[Yr9qFWRENԒQI-HD  sCk%-{(?p?VG旨{^6jfVljz_X_LEtA _wj`ݷK" 2@/YdtR}86yTG׎fnSEQ^ViUffll3e=Ј<Ի5#(1vɤcxSN)o gs+74l߶s%|hR9_g[,S_$螮'л#^A*+n vᓑ~¿FU.zN%ܸ =u Kƪ:LX6˲ K& YX56ۍmF8bb R8︄5x.ʴϸTѰ=1:~٬ǴK1M( FJr;zu 3jyenk,6Љh0ҖwӸ4IFnC70rfc蠤1v&ԅ?b+(/Exٝ-Ja#rPxћ8 ;ﰬkb1O.8~|>yƍq98ԅ,э6g"4b$O)dAdo9 (pz%o'^2_fߥZM Pfq e!kaHr!6lv:J-w@+tG1H =>xWn&3G< g=D>& &)+:扑ę[Q .wX4a9C?[bElf"&x#km+PjoFH/vX5Ѹz;B]jK`oIҬHG&ӟ)NʹH$ yz2|STH`']~5Z툯E 1;rcZʙONpqhXL> KN*8Xt/)6v@?ٱx9.NG\t rr5sћHT?,S0[sV!=/7<5p&茵.!\Bqɧ$Eڻ2nxEN),- &\8KЯn> Q&$O&s+qJk~RJel܃Hrp-*a+5a)t+` u'O9q"0Cy8#>L=si^Qīpf»2? 07?Že=[Yǿ[uz/M{A|*᪤kpDS4sq0>"^;[nxd;UDv\~".@[?OƶInlqǾo avD}?ڦ]eM,uZ!b[LKut6Lٹ&<)[䗉irmV픵ÕilTUŘURL^MuXvpma 9?x opvܪއkЪ^a1՛_H,MjVZ u¸Pp3Nn܎'tQ_6ģ4bn۔ɬbcJug|107牘Ô^:KeY0;gzr2  c%44v9|U@?9hKo=bhWPK{I_hg-;z, ^AK(߷Q0gfjfc3!hΜC0|C( 1JFTL F}[6E"dve1 lZZ7sAmeSi 4}A԰M!~ cQR%BsK"mu̺>61*SŻJnc仜 SGI!܍/a^?e.sݴ^7/*_kJb1Ϗ|K:@')HѩD?#7х/jfv3mg/>]meEWk0GIDjJyC$^t5"!C4s((tRmԚК556 <$oO Y {)$xC6R(v^PQw Pd-orN#FEmyQRLpӥ h#GTxﻓ|mu\?NIYt#ONԵ>!V-LF,uj%U%є!z9KNl" j.Q6 ]VN_Wc6M($.T-DJQp|ysT^fA)b"؉ !<7uMi.:7J%Cg=f.Eqr7R|M1WSB -foSN` 4!8|]PB'#1(" @z0Q'2s_eK$_V >g&"!>L21&zY@;bP3PIuHD;\z?Hrt[~q*odࡩos9#vz6ڶk3)mpyL܉ɪ_VW.nd9Oʤ沒㳐}_M͋^HUq=s{QS8'&  ;:l Y0RhwS[DϣKdhZdYvvq*ZCMQ#kW (P"8ξ/TICu^g<Vjo,)QځXEC7ʊSjD֐ HHHEҔOċbi|9G٢rY#"JRAfFBg/G+XƋƇÛ'7~r|%5O%FhQ\=pN#Os#/MSJ'8|}2|A? ) B8< _.1|RivArz_(zJX\H! 5y*#<9pKd g"CLn潐}ragk8Jl;d;=s4tof2֬|wʒ3LNgOw1@?G\K$Y#$E?=r^6lbͻ<0CuYA.1ifD*vPZlUӃ9ŪkX“jaEvR%s*3w8Z>!]PJFJ֛/DކnhqK㺟o Nv30S4X.]3 Bw$?:T)aUY)^u3o,J}op͟4)# ?侧qD>8jHw?3Mh(]ǝVU/=hs?d^˘a_H*ɦ @ r:IMbsqBܩG]')@rN74u,`nb8}Dm D 9|,_dC(t*PBiA&w(ԴG| &H<D Ǜʐ1,^1^GԵ{5q<#@ވ .QP bx6.w2 :RQ+8=E8Z\8W,^9w3Kvp&Fwm+f&RۮF'%;')%u>-'!fIG$Gp-i' '7w8' V0rdK&10F>mv`}'6 cs%tI8 Cʅ;!ws(Rogn N>ٟggpfIy.@$^iW2nr d/7go7B.#,]ʻ&\3k)vvD :]02$LQK\{v 5/;B0\ŷ"tp`*@ Z]8ɖ%+3OY^wR 3T X~' Ǚb.pjj8Dl+ LvvD@-⣌дf^gR_3,s}@BuY\/B?ǕWe52*eXup=[?})Fd 3^Ո`sm(03ra?&n WU{c ;@Y9:7a 9kj`+(f,b;t; NݻH eTc,u3kdpo\Sf6RB~WDCA̟%_pgOUċk>) o΀|I]%HA ;;a\Hg= 23FSzByڅ(gro2N2!^1 EJd[g%\i3W,RA }F1aUSۈ7,]Z("8.+SآNR$?VDn^>4N#8X5{%6$b9`Y jT?nқѪ\y=Q ^xVI9g'R3S 4b<ycYuOQ7zfDE0uo*_k_(Y7CGuu枦 K{6Ok|1i`{}>jyu۶V#Ht4ˑo*\i\r1v;Y+3*5^-y3R7TRm-酅S"Ϙ !yz6nm.$ Go"~ -EZ+araR UZXަGFDhFm]Ar<4 ;D}% ]PAi Boh[ p Cs1i_c1S.h[p&&pHXDƦ"Rhl{_MƝ5|y5&P~#ͱg󔝰őمn-^+ȞZG{2fmL6ZÍRj<X5ZdDLE%5y?nsGl9dZvVU}5+k7YGV/&9 'v %5ʑJGx`SFF߶I5*>aq<ƮٮaF)%d}$ MGlQ )Lkd qt =7/딗J 3atInE7囵mFUu`ߝaUƎ\k. eYxbd59Nc'4עA"Kdsʮ6c-֬%w.OUkys3&Y?'/ ~ʖHҌmgX԰wEجBE\|mș7CNOqgM#?>gGm`xߎ]ÅoڣmfƬ]|y]1<'8y= XI~d`fe{epwݼ=Ԍmvւ&C BU 0w:O xoj%{.p5ѐGTTEֱFgI ^eXұ%#vO~Ey!&n#f{>8ͬ_f]\7r=ƛ:;/bGYL?;zqɦUTJÔ SPK,( &25ٽϨjUpgۚ%1%*}k )1hڽ1]zMˈvi Hu~Bj:iV n7bd?}Pb>sx;᪝]/Oim%5kp5?NѝXܵ%.u|aO"FcNH]lu'XV=r! aLK6h^^ܣaXa!=7105UJ{(s%q +>o%;<5AOb< l>,M!ThAAqCP狱ʒWLj[nJߟxr~Ae4b'ߊ,1"c᭻'o:}aʈ-{{{>!AY\Mürcw|r >0oߙl`3ֺkvO"N.džF7XEՑk^>{˾ R;#љ )QG`;vGn궐Ӧ׮sVUԁ2uN`s&}gGeϚY, h81#Y-kjgy}] ԥ0\ ێG | %qI-1K?pjnqXSE_98UU)4P.Xg_E;@:{l^4.Yq]Y̍ZHf`pjGu(Ku?u%Pj'L-;>G h^7X8#W kUDlɞ.M;l;=rҒCȚ>'섓C,?dzz!;tb5uk#k?K;V[>G8]ɮ!.3e)4."f_@=Sl.\r1^-u$Iv !!zrv;l{em1<CBt7)@{ك14}uvAvԚpUUV.B'zmnބ, {4pyTc֝d .]q3$g;X( Qa~9cd:|\©KqޝbUۇ*A]Zz5t:mEN,IJiCtd> 9JqmIi,DbcII+P~\@<~C.,$H(w=[5o'?2'DoJK_idTߜٕˤ3sD+y g`wo܇^I# C k]s|G?r}R{Vbs%Ow$@wödʄA&~aE)>nno^:^k5R<XB7r.tˏB-[Bs%\^\k1t}U-k4JRYeOA+ve+OA4WCNϋ&I =r`/ U8W8Xdk Jbr胥 5Yo*K,# Hkj2*4\{NϹ,Ş(>6~+8>_tgmSI^9 `aիVH #O5_@-Fhz6T|Q+ﲗaGቘ;Gr0`;bĨdq-hހm"GE߀A !3Q:y} uD/AA5oICL|LeP$+;?K:?!%v?D|"f5 c*-"d%!ǀQ@(>0!&ĬbڂO9vuo<9Zf([A]- ҄t8C; ׫}'s^4y:(T<г.J+`( grj,0 s0_%B0xIFzc&^UV*Ga*X`~:X8H|0'wH ; x֢19-ѝ!LAZgfA|WdCƖH[ҭoVF# qG;_)kt'm7eBDQN(ް q֢HZo#V#$Uߋ<ܙzu͋*{y`F9>.oL8 ۢm;)spX֌M{t\Wvgz򓝈* r )'|ncYDkdloI}0-y~,8J4D4JXWe+sSbrr~!JXF:y7o[ 4<_Dq^$ԗv%Zm{ *VȦ+gC `r+p@O`V"H @&pH `&|WB`ɺ"L c񅨌-`/zp]&qœOZ>C$Y{L$]µ-Å6BGA^<e)>jR005 x3;L3R"U:EHc3n>"Hm#;YH/[*x5a"xCB &늯d_aș7c.;˯bs>`sfS+4xw7i8ȏ:ɲ :K2wh:_׈>ǽ&SCc?Š$!sXWH[EQ68\ Y"t!Aka%chﱫ}yZPwk /Y8Oc2*OTUMJ*} AI1K1hwY[Qj &ډZ9ii+Fo!72cs}J@(M(գBmKW|*sMV/n#ȭ~\tNU"k P !WPhVlDs0pIuOݹsmƥvMj#2*jc_vz(*%?h.T-o+ۮMK+pw*r0*2eX NͰau ?"+jb_KJN{~Es7PNaRB !!Teɤ?~J t#葖 rb~OI}]3qd\Oq(ܹ02OIT|[*oBG;bAhʟ*u"B'y{*Ic 6Q{ҦY<IL#I<=at"H&2O)+ 9f8FwaOh'|&\R32,H%rQ"p v9W}Kfl0uK]#:tDŽ&T:~ +^;g='&WÄog|e;#(t2OenS=Uc/h:M׊>8{'N[Ϙsquƍ^tNYĦȧ-rul.fݧd6{I;~Sf''XsAYJ"vNM@urf0*gP#c/e˱4+cyV DG^m[NI飍ab3 >YN:Ahhbw5^HJJvLr{O>66!OR3Խ)>eEIk!r(,DPdxv,qy3gR1qLW l#N۩OĿfkfPTx i4D$jq+#'93q584wl,L hnnE|2l&T‰sem GY1?1̀_l)lqRkz>BJ@LPDDBIEIEۣg?_y-(`zj+:f[g4S-椕yԕE RZT1[5'qz8{.c*ce|!S%zP|yD^_nD<DO'$]zDY$'hXG6._gS҆y+|)(W=۔1 o)Frysl#YZI֡\6M c^͹ŤNavƸ`KcgR5A#RQR-3CDZ1I,ZXcʱpᩁ4;go_g-oZynB١H]5`a5"|)(kɲwJSbO˗7UíxW(ii:q~tFքl㨒f9Ζs`%pe!\MLw>Qr:WxJZAB (Im/r3\Nx[95IΒ[dEbx/%ɶ8Kۤvbx!I|"Rzw#bm8gJfz~[iGhI=T7#E7qBWِ+IOc.yY$TЭ2mU-zSio>QvX[4&?m(Z.($=շn8/L40Ƙj[xݘ)u/~ٲcT8j#~ѐ X7/o8̳ [jیFf;x5p8, +|'vn#mw^dys׵xy9c` Vx'H^ߐ춤/եbhڠR ؘJ5LTApyNhwn@y^+?te7gP9T3+@=bĔm0cc;LO#:̫.C 8#J;ݢ)>|/qꓟ&(sJ13| 1J.uhN!-H'~F'(Ga\2{V;%1O& }`4:%V$|ɯ׫e[AmE?X/pe/X(N729vT}yK7t*ke""| NbͰ*Z I^XZf):^wNRӢ{(r`OiYP:&{/r yAΒ-8%ShR5ꢎ ̩TUMPHr[isQ)Dze#iʱӥf[]-i-ax)$6ׅ?쀫LYzVD_pLgc]"D_mJM˫Հi^(U- :-3`YL3xnh[_qGWWRvjsT\ޚ& jS-bAQa֓cCN_}:_`Ok\`cGk,7! l  (0PҡMMH. `pܹꝥh K_g.O6f!: HKeJ>]A015gB zGfwx|s8/PlPZY kJ%D,"ב(nr n-6{dY"TĎ[;#I7m^Ax5ksf_qÓz΂Z!п5ʢ.ٷiLo.B˲6k*어 ٺSՖ ﷀLM+w~%mg\omUXK'ں -ElG+j'S|.3 U}K[^G_p!ؿx~G/(˩> d"֙TgP5uY*GvrYC/\C{ŶOmk`iQb)1vv8#'hp.bd]gϿ(szzD}a?uqk nAxh8@uL44׿o^}_3EpYBan%bjJlH2nn v1 oiJ жmm^Ku5Sm#Ե-EZi .`WgRM+Ǻ?]/[ GqKcGUvjYьsA_[2z4X f/F 8޵CW2tLXZ1$m i1m4ՓG or=3M'y.A*VvrG=yȠVMglAM%"WΈ==y.Y6~D} #`]QWۨƤnǩܢ[+/ =ͭSK/X6T3(f[PnQƴ2{G_wCW-ګ<]bp]֘mҟB ۭ`R<8i[glo:Rb&xW!"W>q }icx0:0`d>*l_1,ߩ<ǂ79nрLc 9:Q:ҟZ}n~&nh :E 59SEӹݹש6M*ldL\eu|cW&?>XL 3v1w);3d70i2&e& rso6]: 38:/pw! 7**`UfpQ~ãtI`oHv`atyG٭e >:e{]SpxxPY럭HvIQ|GȘka*3jPV%n=PB]vJ`'@O)"B5թu(q:kV>*ost1e!cY0n6nu.8VKT9DgJ}ʤZ8B 3nvMKw+ۯGtA!@.tdOqoHңg6k#L3& B~Mba SpوmU@qT\r(~vs(b?jg ORJ#Wh2-qB6c,1Y8?,+0!!: _Dtt|A0 bJч#Wh9I3 :NzYB}s +E C$c`)<> uj izNge6Xܣ1X@8,S,BSY4Y 4`߅W˴<$;ooe]>!lLp,0NJd$R7%WS d@D<2C0R4u ;m9ojjF[ $#=firyvC(U&R"fɱ>h g=P<wr~v:/-W!׌Я3t1^ӧ~Zeߐ=v*ϮzӍ&P` օCRs@MɍnxA= ?/8Ǣ{\L=oPLMvG_w9AN]ݲuv0Q[aX l~]ԃgl~ao@Y0X$&DPgEPyK5kNcRDցLSnj5-Cd[j0]\`E#mdAmQ3DꩼhRYuR|9 ;\~ƩBlksE!W>EH[N% ٿduJ07U't$a0\!~خV 'wA܃++k[ˑT1(J_ XяmBcoԙ0]lvPI{ vv1~YH!\wc~V7̞zaEFjR)iP꿈y ^w.x[N=9nA/*`l%Ci)Q)HmPQk()BGy9zC بlJ9d^`}}B d'?šJ2t7͝O_lgy0e;5pk4h!uEx@?ڃd{LOܹ{T^(IPR7m-o[ǕM⺥g/  kqP]nIa)M-='ƹM}ɍj~M*o".H0&"u8j?Q܋'Žu5.h]Qcc9TL+a__/3L4>< V*F DGq#1?Y-]"F^1J [kGu3pmh4L w7^-9 'ao,بlV(xf1x5YJcgbWO8dB6qZs 2 N` (R0!J72rث JF{b)ގ;Y1+moM g/LJS2qx-v2\RL"#=;qˡ\BsY3wxBmK72ɳ oІOŒKW'F0֐SvПil F7;~uG27\e.23jKzI},ϙt.N1EDEC+T+hSx7RƹֹQ+*(zR}8?fG؛Si:0XU'Ҿ+w{:&[ {O/C &w  S ӏQ/SOkFKr R*G_ͥ.fR;'KiHwdϤ2馴~Rr6Olw62omSX+,u EnRn!1T䶑kQiebugdiZN T웖FfSnjR?}QTn=%qM9e,חTb+m qnk&>SltH N%\|-M(;}q$]V⇶ģ[71~l+)5$⴬v--- dUDj{Ai:^ ?"h{"KaIc~@F'm5^:LC; Jqk#\(/Ï/E-Ka/YU\^Oգ7U#\1ٜ:,p,7gjK7||C/S HE>Vw%@'IK2ٵ$  4m*gTh{'핾F3w˙)q!,;HK/̎f;ҙIɬyNd/gCh [7/J4X Pp52|܌myZf]h5}k6{ ibܠ8Jh||7O*{Bz]%sR$ HqAff! B0`qaԐqy.#3="aY63Hֲƍ\yQ:Dg],sOɾ ȦדW\K*7|xC1!mͳJ9E}1^.˦]VyR%Fᅡx3a.#)IO%"fͩOĥwh$yiפ d:]В<6}0 zS͸RJLKko1.h![T+ %x):JQ.{Lu|Q%XtTAnTnKA|gG9ۤPTtz|BVrSM7ir:/wj_E_sW7}#< {x!}` {A3֣Am\RDSP׊2d9Be,6؋'z=$r8T=J3WF8W&HۨW;  DܹD@!p^)t) &=OYh R4+Ձ|1mI(m'\Nod{BCQyQ\Z} ^cޠmcytYWh.3bk _I,SFIG,$<jUoF{1xyRĚd5Τi` De[!z s֯IrF89]HQ>d)l~,34Vju YCcp.)Â"gob'!K80CJʖ#$U5gD̻rs-!zl X]^.&8y3` .VQo!yKq${@5i[9Yq-wN+afm -MZ?chݞQهm(%r:[%slT1C`Ij,16 W58'uK ORB>b;DGSA!@ 2Q9b2#76Q? )S9#VhmMB ijG4w9 >)hYێ@<"3p 2 alSyqäIψѾ+Mԉ2BMޚjN!S>FNJT陲*%[9^.@k ܦc2'3V_e/+-*kaFK0$BYLpЗXWq ȇ+RXH/UtG2^qV2{ܿO\͓N/'Z{\mo,H؈4{# t䩥47G/s+}GR/cDW#KҴ`][׿59:n¯LJ6lƕ֩&8@TVCYVy)oICn6 o]}@ZDcG&f)Wmgɔj@GXg[fVnk fo3d # *%]ޛT?SmZ3 ȍ-oYPc Oa/IWa9ީʷܩ6dfk/|ر7ÍIZs+7dQN#N,RR^Tp*;p2kֺNbhb*K97+;V,MQCdJ7Yw/ي(yc`b0m!3EFaEs)E]7KۧZNuU3'䮢Fu{MC>cNK_*[?t 7[m_j2r-ڕ7kB/飽ˊ$ܶIYv|Q *Pɀ]Uk*v& G'IzD`wP7{FƓN#@΀c',g55ըcsv.tWe-nLwn[> 9;m sHbW7uDr] :}xw'@I2%;0P䟶9%aoD;@O8ɇ4 ӫQ }P-n9ɷCZ\ X&Ylef'|'Fl^T#=XbT&1l͗v192@4PM)$Y&1g"E?9}̬N.mt@HXkL e^Gw-^G*gPDu'I@ىl2$oWZ8 ıw6h^_7z{tL ˆ禓U\02^fMJ =^Y} 5r'ݷCކ'YAߍUXH , dFR[SS1E}+E!w1(cNt4RnOhδ {^[;~3(+k`d5{ZaVW rs|v==yBl4ˀ ~%ɂ+.°gç?|q׎>m wE ETTx\_dJjkKٖm%~b7qaۚaݣ??Ǿkjn}74_ӐYufJPOBܟ"1nf|@[3T1miޗɕۺnj߅wJYx'ȧ}E :>J0rz}eZ4EL?ؘGYmO6YP.aT |@A9~:Z9 >sjͨep&Q6e74ʙ 9øDh\zqڿvd|{B"2Ȫ:,3j6Kd͵vDž鍃@(?ۛ.E&CdlaI]?; #J>:Sk+'>)-(::Dl  t6r\lBۺ޼jk [ 1vF 돫vȿ75mKKEl0=d_wX9gBe~K:}qS,u 86/M[͒pZ%H.3ώV. ~b2Wϯ߬QWWkqʵo@O&CsMAgAn+`g{])9?bj+ogԕQGqUC}nj}9߷!W[7AݒN3>~]Y=V];%baܘA_&BXmeAo᠈>FtH42pL (n s&QW 0XfV& qTI&`L R bصءb7DCޢ`5St=qMHJCkEt%ӈ6rp:o.v,uHΈ(D{}PmS#- ֑@ U&a(h>,k9ϠwS:;˝95d~KeD_- NR[x;ηd;X<!ΏruC\bQ[טt+&ԳsCMYfP( ?YkFM-"XԚ@;gުfҁ ̓F6ZN.[sM[JyADŽ'#iwϯ|yQ~ibF?򍧪#=vA z۲ w^F$9\2PZAտs^`i#WY ZN6e ͥ!]X([}EeDp{5DNDvdUm&P+(1 'dO(D؁\~}Qj`(503YW}IҪa6dp`\R2 J Aha-S5eսO-PPm&p]f5Q-A%UGrKچ~;8Zgi@DQQtw6٨_ת8 bz}9}v;aq_~%'1De'b";&AQs+I6]m~m9E‡;Fv:WJteAYjS))1Y;հ';ird>X;.NwC/]`MCF d(G-3`3a`_yJx7t/GuKȇlpGW0@  RFcaZr_ q35qrA^B@F3loAOI]}I7 JRוހȟl~Wӥދu%4Yz cm۳Oh}UD7!t䳶ps1oI 5SNvANSt6[PK֪/U AeȔ/Z%4X\WM,$mM %՗CsIƆO%HYw27"A⾓&!CSffxi0S] 4.jMRS8| yZ"%z7%eċ!GHߐ:Qh%N-AM< {PΔ(ڳg6RlؒLb vp.}t }2oŖ+*b-vB.$FO_ႈ6ш8G|>$NxbJ8`FFQ6|`&7F`hU I[6 E:i!\ANxޡ<,PySx }c  uvQ 6ue'4n.5*T69\nCzҢq3Z3 P+!ed$@5I+%J3 SNىkekpݑ;̛q=HIp}2߁4-PȇQE($&o_ˠon!]8zı=@B底HeTβ`5؂Qs*q(QC^z[l&b^0y`KA @KbA5 $zclPni /+aҩL`5QZAPwAEo5g@{zZh،,Gh\ؘz#8_|Q:?TB>̕iHÑe= )9uSsd %L"o #HgiQ3ITw8@&RwvEj~HN۳HR RGk"oJBԳcvP).V,[mD.+c#Q„ٍDٿr_K,S>HT]붋 3s~#~i BwNu $/BZA #d9D.D=JN';g~_ ~]B ΖIS/&)A3b)'|~DR>jҲq_8B։ۭx<$0Sb󖴖Ywuy7ڷS"$+>%lh7Ms~ŕi|8,u [ 1˥ <7| OEnt^¾-Œ߰æC$dS\<6XNn-*mIyg.⚽ټܣ9`$;nu̞O|@V\0QPȪO@rQ%9-``;v%Z<:/Lm߶S8SQKy- ?W-W:"̛@.r:1:1>GX[ѣnwXzw?85z JeՔX8̖\0I߻ts^s.m !&2.)BC-t/ :8M,7PjߔzvJ*6 Ydgѽl)ņ4,}Q}ْDaş ^K_o4s^Z@62x"ZI&|'w6c2ޚ\ia\vY5"J7ً3Tʨ'J[:TΥݒ(Oka(W8T+ 8EԍzLZg-R8JITԮN/'ƒY.r*0Ot vK8iiwʤ~lcY["=|[C:L%zIϘ[tQUe/ !* "RJtsEwc1csgYZy}wo. ͣ@a+5x4_/Y_9~s9ZyG  \pAn\B7!AP?=:^݄秿 Cc߫BO 4o0Ϝyy@I)4rXB '1K/G@h՘~u:6|LJSU*-B1eI!_ŠjE%m%CPjbjiƛ'{ Sȿ)PEr٠F }*͉R։9AwRoWӳ+*+rksO1{Q1&K@;p3Vh0@7Hu1w{q#VIsAse n?q$ j2Bkp*1HPVEaewc%{CH {oB?@lp 몕'WX4P-wɷa hټVLm/aK8w..AS7bݕ :C%5Gjr:J۪Pr4bEֱYjO/f7Rq)$Gw?pƞeEs~x}%):݅G~U @6mʱ9֎r6Eb});˷e* jFsP\hE`[UؠK*[*id{l@I)ųگ,S?,&mlleAUrD]`8SE\RSm2p v |l &i0 Кl^Pa8)쪥O8cЃUcFdk\Cxө0کDKxKu !6o)iu}Қ%<{}Ҹ,PRK9 sO>lP<,QB.i 0 Vn$f-ͫ}4cb:+^],Q)QVf6&3+)ە53ɂR4ɮYURNŒQ[j0ڋjk嚢,.Rވ$( YJ[r_{\0d.İ`ڍbpJ6/J##=S5]s7.v V!*4-o7=jj,[2?[v']TTD3erpc;TPsY?oߴ }&@!Ѧ 7)=JR'WԶ,jiΔ;#=(Xs~eح7 ]4X'JZ:߷%qnuC[JP[`XT7LY {` kkplӂ8nCr}v)3a*[&p6f"5v41fo [kzQdD|R.v* wIN|i?FftBm`f{P}{fm)᩵s(ߨp -oœ1?/kf.`7[No&Zv9Qֺ9şٿ"eE7,v^V&o6f.C 9OZʎ$ڣ͗ްw^_1M ؼA_1ȇkE\ns&;3dAiYUWtAD2, 1'7i|'LJKlF~pO{:ujs[IeMTc˼% C.hݸ/5:k`F[[BMH}Gj3] ŚU$MleZ\s L  i[߼*kycA&fJt[ u).5LqRuO=8-kiUPm:ިhy ?DU|"]M ~VcGuk?p&VIQxjK"zɉ rj0%:cXzooZ뢾G}6,ϙx[2,4 M[;AJ~O!N,83 dM%ǐ.% LYιH@x#-C>ڎF|!}#^2HN$ή$wi&J&|!лE|VOsHшUSS>zitY$}u`z`Pof :K)BMK? bU,5gݑrzf0az&"CXBQ^ VO^|؆(?i-Λwc~|'|KE`o%p20`r "[̔%TeW,X% &4`#1UT%aj=ޣȏp xL"Y7amv5ЮumchP~^2N։_{ڝ3ZFtvՌ*t%ܨ>v̞̆}>7`bG8&=7az>1sJgxAqnBk׏l{X_?X9xCۇ 3GmGr.oOC/wA~ij%hS G,-Pbl끛GL pxeӸO[1߹h3Lxfbfu]V d,$KɁDymRQ[i*̽忞įv>}uxfdqDŽՊ<&K'zG\H+H'\Ly7[6D>\"7ZG aĔUש -#5&su@һ1xF[@N2<]d|I%.dWՓpw װfGgK:"0n?qa|?S,WX37<^=1_MU9uPs:^9"|N zI*dųb W[_5A(z4"mS?_tH{j6ڍ.R/aR 2BIr 'tЙ[Rt(dڗnB1ǴaC Tl~o.DuށKrֶiƌ P_txiewyYozh*n~+v{΂%m͋ `aR`\WveN_ٱmLd{whļӫש,QOk0V n܃ό˘+0y+^*0QC99y?:q)"pO9Ɣ;O`ҵܩ3 aWY Dc)7^ӏQtR#97ZJ!S e_h$C <B ;(~V;&n7UilI"y*}* Og_VS0ۨQ1hL0ms7Ʉ8Nc|aӸ 1##q)o)8=$sJ\W+((l0u!i:.KD>W ׊K=\ZlY$|>F>(|녢h,9,[sH]hR= Fl!+KO9QI2IH!; *v ƙڌe b͆,7(\bnU]!c:LTK}}3VTQ-!0rAӘ);Ku=2D_ie8Q^].M#lٰffyD&AHv6@K4 "ɺ/^YuW q/(n@u%Щ@cI$p$P*M\X+B*CEg_EvUB0%Z3㾹VKwIRwe4,ڂQD X+܉U\sķ naU&@Ůפ1NF:/ȢGVSWhOӝ]̀EBQ& ɻZA|[CopPW,BV1׍^P•a3~b٥xr&wS&s_metI*{fN/pVt߻F{9\"w sJnbnr|#-LYrHjI?^$9z&0=G egJ.k#:&ӁR7M^cۨ~jPnZV| U"}XseYwŚ/ر- | v0ǁXCFRV^cκQ &TkC&\dBPpG?:1^6 lg8 u]5ܹ8-7i:$bB5KD?GazC?2 3ڎse&XlQ1w.uU'Jue5\m^r4D}!r, PBR)ϡ6J$zMQ7⣘4﫿Bv}UuTde2"-/Bm䏱)ʓXc =H;'(*-(ԡ-Xr1)%]恿J:'RH4x}$ɃH$kRiJOb,ɬ,tv$9cN@|V/PC6K:`v$i6 3c;DL tyS 0yB<STJ L;%Yru_as:J [|޹z?A'&O<Ӵ w &-]Nȗȥ b4Ĝ#_&  ^OԈ% :Em /XI2IUWU/Sbyu t>I g)l.B~&O`,tW>G{&j&lJbKjMVg6C(ZPps7:SKr$ y9wb u\/$9!fصN]/,CmYeǞ .!C u"? aϔR)5%\y\cksj ;EAEB#EK5y3^JR璧R)/$Ol4ku>QE;R^N k+I_K濗VJԪ1WxO!@ jӦH^[cP-d)Lj9l%I:2W Z%UIM? L{:CcjTlRdeMVIXMwHhK]Imc\Lr&a]U":kN}kZ i36l\պT+-42e{77Ҝ<[".e>_Էt0@m'sePڗ&hh3W!oyӛPNM?Q*|vB[;;c.3[O!?䊛_>kr8FxXX<1:嚗}MH>;j{[?dG]'_k9n\gp46*4aڥl$tKM#Gtos# w߭ߜIаwyD(4eȒ ҳ}R|f $()Bi$2W4ݚwa[9mME/>fܬIȼxY ֝V-]D]zիJu+dY;oS5ST12эɍOW҇,١SH @ta cQ:sOZ\yv-CJ'ҧQҀ\z)p>I:Ac/|| Dbsg `o+cyn8#ͯ'rA P\NDwp;/|[C*nnTzk|$İx1>Ὠ:/$x@w 0p .uaމŵ²ZMj!6\5Q[9* Vev ҡ9 0,.KFvM\ޔQ~ @W0jV6ۭ ,V 9`jhZu :=?1'QAw .iֶiANAq"H?~ `7,t}*i{SnϪ؃&VmjZvd?lr[f5|9Ѓy`B}Eҭ}@jߣxReӗV^WaP}060_Oɾ1rὡKjV4^DN3RQ?hmp\ؕ}gq<Զ'Ngk_m ]0]֟m/ @gx݀1 cf|TB1̧rI#X6wp4v9&xsH qI ".ǗR5U@>*p:MuQ@Vp Л(v1:(&0B({V2!ζ]wk9Ԧʺ3Mjev~n( ~ș^ ɎDTp(g4(wu^A/;U_$閸8I~ guu\cPE( =:ĒM}JK!RY4/>$^Tdzݪ 4OV鶕x4w^54rtAߢvxE)jbW15Fo XYX S58: "7q&^ښ m^ߚuHfy"8jؕ1|BoZ ކѵyA0Sg'ˍOMޕW>)U0!LjOm%@sݘÐ s7ӲжnuƯ Ջ3L z|6;:e#mHh%n K.nTnb`E$.n&k+>!+Nc\+$!Qc8o*-C,r6OT%fӌaO"9#><E([س“PGzVN@>dutlF[MDe=}r=߈,Gߢ^_‚h1$vz\6~;p 5sܢ۲w!+# aOI-F2vz[geyv!{_Abȉs&V J4S=pETtpt)N bvZB \Bm7vӑX СN_F&_MdR)aA˓Jp;-9K}`Ca%<=xb+ꪆC0 h _t_fSm^q Gx)7FG*B*+^tVZQPuy[K`nV0#3Rt%Qn]0Z6PpXPkSSwŐRAX`=8%0KaÎڗNOÛ[ =n9;RJ3$?m8OlAN}Q<Vֺ~xNKiNxÈ.m|{=t"OOFV{ 2Țd_JAunj m "JKjduz9&٪8xlFjUhAH~2Q%H /ʢLE>LH9~ĚC<鮸^veل\62BAWy 3H}iL(hy#[+KOPlIxM!v;,3ꡛ~Mx$F|>&$ 0|H!!i7zg3VD:LALwW0i#:9 b b0)(?`DGɺp:;n͋>_Bn$Q!>z/KB?6谳IkJ~|#b"]%_! Du]JFd"7bllo>[9݅_ZUވ`Ot &~A .i֜EQg=G}Sx+5c*gj1P{)~,j7Qȹl~2K30_AA8_W!6-Ayh=뵳П@Q38 E:1e WwRDPK 3^U=;diSs&cw"cQ`,^_45)9!2p@h:FC  6r]8x}uԍ_3Q]dI\0s;C"By,c>3yZu` Y0!&p.9<5 n`2gzN vP@F$<:G˸\pEŒd774e%N<5ԓE8tuMbs8mbzw qJ Hu[DesC %>y [k;zD&e#]=(;BJENɩ/W[_l>Rt|x7Gʘ^&11٣JZmɀ~;=Xkl~2b{|wSÛCzFA`[ޢ įǫBHpGؒ˸p˩D%{]S%DSzOl,_AX.6f%WE 3._]7D~r3/nNTg )|_laB#܅un6~H؀L%q3Ų1_;`|Ff8.MGLМP?G&khoyӎK# /  MobZGU [m1_`p'35㤲64`VpS(d;X+0kn.5S,<|oR'CT~vIp w8(BThc`?%m8?FC^t‰ޏD+(]]b?VNƋA< / 煢OG }Noɘv@Cs 8ahޜGl g?2JQɹqL{ cB9qQ>@jkl )1R;N:_k2ZXR":MJ eb//(ӝsRNXaNd0 (rBţ Zt}. eL1:cX) cL!C3;١p3ɢ2α<']U91iEt'Ml;ɘ̈qTr7LB$Sԝ;R᎔[a첝4&ԆG6o aS O>EYFNQ P^)j+lȡF&S3dӣ[_7%#l)ySǹ5dqqE[^)_N 'v:Մ.rgG | ZMqrC\}ge"95k6mvf'*P'벫53*FdRCy^5k,Z~&s6Hx^vVVѐ Ha ۊ6J +hk{\8D 91jH nTz$ل$D`L |I@V _g]+>Yj=c2.~xol(mĬF[DR›8]]!_V%8{HY4MAVp՚P:,$F^UzC$ni8^}BlWs{BYфUc.T8 ϒ6r2''XkA쩋p޳fm67xs?1<-{i[H G@j8 K>p 2=8G&4p#g3ϲ?j`n&u4rM arٞI]M&Ul? y3@0kHv{.r2V*,ky6qvz|=u]$Pq )eHNonzV,Ԯ=._Eal ~gc7ngn(_'g~ѯ{\+[8< qV[1u?h],l{z 8 m*jHŜou2 L3ѺSY )lm@G'J?VPլKlx5ο)&S <3KfZm(tM,❵ᄃ_.+]vUPަ!bT0Ӽ&#÷_} pIVElqLU5'IÂWU.SgWMK JI J)!F;}:vױ٢Y{Z36;հgw}֨F^Ѡu}8͹ċ䔖i RQMP?'witnA(Am/ktZ?O V sH7|3W7_4Ϥհ# [ڰj硏61\s;YZT!Zy`N~InwsM 1jP+lYhSNrN>,) ?EMj;鲲5Dj@ZNrQE3+cJّI˭hK Pm ۨ~^ДFAUlշyʫ*F*A o!1U [:G $'IZ`@ Ճ$u1qJel,T2`&+g'z-˖N{3dkeUVPsKlZڀvHUG;4B:X%m?2?̓f-LJ{MdMn;Z(jGjXwZvFhV =}`'t1A/)Rf?؈lijnn[ MsǠϢ%pڔĮ'z ;ky=|f݄,kr}W5=ʴ&'8&pyQ]xkӝp@APzC=I]qaswa1z­)+go $^kiW>_ &4-#b\;$,@ωkxSޘhhwHۿ.308[-5|Q3xN ƕ4zXŷv:߶џ͉93Y]Vupik뵻3α5S !$X^y] mˋ3øRcol=xoo6!ɢ hh^cPBb̌M5RZ[gSf2~Ag0{섺;0UY)Bmml)&bMSkB7W Au7jy%3lwfnZt^UҺFe5-)ffwwX Rh5nOU vHM| zzSٺdkyV+#SEQ۴"(C#1F}Ф-uGhymt?m95[3gעhD߂.QRc۠PG]Ԏ}n5fY *9 O4̅]1< v p`5g0(c-a&oZ]=J?g 6`S3c9'\".O2xU8iFt!U \Ed9ʺkJŢȃP2[0E []==p2, X{^̣Y{naJneLJ;JL?Jʜ&&"(N=G)k閘2~ɕN'/+_;N9`t$mW80ڇM I'38IbyKdvi7 N`CXi10J.qS?ɮgS]e5&[l& L3# Z  U; *:: 9M\2œ,!V&Iʾ= {1i :ǤC;`L KmVVկUwˮzPjrZf9UCG*'ԣ=K[6pd|ho"&Io; j2cSB>e}کՠzoX]:G]۞_V}݂sWwmҞgFzK!_M"'Z*j#Jή}?uɫV5Ml[yJxPedeH]Ӳ$s@(KlGR=X k`9 PÀ1W~!Ϯ`@'-mu]ڌڽ^ҍXBHcX"T(:RowtX_5#Ie\$&d%:dp;~ۘ=njѢI2.E/H^cA\,kI .&|Eoȇio%Hʒ9Fx/m:8j'ZcѧLJrMO"Ake۽Hڧ0Mcӹ7G>+|Ӊ#a l¥ᛊ ̀olwX@^cG>d ]#tjٹFE]IZьVM~k|[s]&1}IД3U)3!{CFvb,3yzC;?IPgGXy7y.,l{*WE+|5H5)p8:\/=Ӄ+ SnIUv, _=N@4׼hK 3T+`WӿABw#i*y U]]/է}:y'~[)~a{zwv;{: j{!E2:~pmWFE@nzuQM= Q]Mu͑ՠtW.56ܴvȷ 7R|"V.|,kL܄zր}&uϩ@|<xZ2pliVD߮+7/j"m+x ?,f}Y?DͿ x&mu7h' hvdF](4 -@\I"ՖB5rcc % Y P#|H6R ;9C/zNM *Dakؼ7Ҕĵde+(Ӕ4&޳0(%DtB u_`D0HZKX7З 43ԄxduR!& cUg0 0P"s!"mDe]y'6"g4۾4=w3}x' k(?]p $0ႝYdaėHN^h*t3-KWj*KDwHoc礌z1 /ȻGr+"HD%Hfby NٌEZE,mR@+Ab FUg( #ULBlP&4)07)&wONmjř(f63c4ۛ&+u1\,K7yV5v_H0oZ]Ft՞O{W6LY|۔5 iAtTvAM [`[WO=sFϱg䰮KUv/:*~5ln^%u܀,OC_uzO%CFiƍ쮮k%5V^q`wVHT߽Thy_"kGl;$ui9ºE\.E]&OMgrکC荳RhpUӊ;Yh{mcL2r{u]h>^D['tPR'zƺ`+;X8qj,qϑ6ovrh=U1Dj^ewߏWp?1օ'*6 [>I4i J W:HDijr-"7a*ǔ~l$#@ l9*u V`2Q]QT&!>)gETTESM^`oܗ]6.l,Ǎrgh~zCSR9cMz*yLW~ lLg](T@'H]Ѷ;%"Z"l3f5$@~K[O{C뭭 #p /P-U6љ&hQ1wRs^P0XI8+D'j]**|}!oTF3#+T[=zVty%O`+UEA9åJ6l/Hɐ/>LVרDt1E1Q9 =Mq?~ofa[ ,X/uD1:a'З>m D$\hBMs0cp#$` T?DbEрp%|?# ܗ{" TXTYWm;1mNZ回9QI8Q/)T$ ,Hɢw7Ѓ af6=^; gfz;w?X{dnRz5iu5HfC[bM7Pw}W7Ľ* ["7k ?IK ?@[xBz;Փ-:ۏŸ4#)ʔ0{߰Wj~!pۙd3IZ !bW!fR9%柳[.pO0DnG.soO@-| H]e"WFϳ&/^Rv OMP|S 8\EX[Y/1.E7Z*Q#dH9E2^u݄$ZR,Ȝ:?t~9a*_빗Mt&ۻ(S^wh_c6QX#yH"r+{ .Έ㮊N#k<&ڕɲO‡chn `2_ear,Լ8Yc|g3ITy=B~t1 >yxL vci *w_G#N;;EZl'z|BsD)~_KYv&`{4Iٚ)㘜`a~9137i2ux25YnX*ALbs8"'֞U=咞.RPA@&9]'c&6o8S'g<[*{7U Z((%jdG])yx'9RB*KTjFdh (9Q cɒx5'(Ju`c8G^\G=<D#*ƴӞ+݃5JU3lwi/H1AWrQ'/2V6Q* Qzttn1#e$\e';=k|ׯ6Z$x?O% Y搴s(]7ʺsg)Lp.<pjL 7ջ:!KȌwVZm> Sv>–(5H!̦{v@rbSQ r)!8CU(Ր  q/lNqI(eZjMQ]4մޡmD Қ mÿLYԻ,i3`JBpz7jBCjN>{L_}ZߡeVSp;>8+ 85XGtb)4'߸X?j("bHeEdhC}%=ގ:%|XIl^.3t^Sf3vvQOU1oGu?3oj0gk#O34 ]N6ȦEǝ(ד38/+jq jx 4<ڬj*oWj-I5_BUn)k?,YPNc(ą]5Չ0..AtIMDdyu~⛺WJCqV5K A8D,ߦ9s~$ϲc?9]TWu_*00zόyJ.3/u U;F,yYɜFȪbpV1mS7+6ݍ[g0[%UFiԢ)?ByjiУ١귤irԶU߃;M^$r˶ MgVN8c,vP fx[^칉L* Qoot{`Rࢎxo)DZF'J03'Ϭ;/u!tm$۶p8j6P~ta'K;)֬ٴ!m tٔ3fFąf;܊bn9[,mX=~5=r;2k j84imAMk#ueZ~2f-i~VP,ϤGeB4ᬠnOM~~2ktb%.1ǚYf+Yzu3ưK&h!Kj\&=f_{IfQFG0۫]ptC f 'Ƽэ=>: ~0&oqe~ہk!lɅkc=੩ X!_xE D󛅧6@ Ajy"ٕ"gW͈[%#W.DӼ_G|W d ڔ[!Z(M7<|SY0%&DM} |?{2{yr9MCsJ%f0[0Q[ 1丙(K}c^.>:70["Ĺg!dm~tၗ'ɹKؙ9Lӽ{+|]=,9z*Y4op)crLq}F{Bۜ[X}k -er#I ~d@S`mG>zE}΋; 1eVO&^Et/F1uS|vf8[mm~qa}c7IVt $kd Zm2j,-?;b5u 6]8I[a5H.܃ZM``pn[y0Dʧ0: ޚސj&#́"ζ0n_FՑ^{)s;ice}U!vQa7hJ4jg ' ϣ9^7N<>Šd%cLˈn-=ɘjXP2uA ؅gIvΐ7P9h r+:Ľ_½UV"My Fik@c<1Ƕ*LxSI2XLd}|)NEkТ",Nz%\["H4QLE$U¡t@yPAT6!WkW\i${nݛ<\'aSe;rwЍŷ !U]Ŝ3huM#12sdSs]:cWNlEђ8a骶g^5Kj̯|5U_y ue{r܆YFCeE1RQDTn@MC5%]m}۶ƕ( ]g\l$YFL>cI,4BX.LɮvaU@?֛ :oLm9햙GWV9X_ ➀j1aV"WյN~!W$cXӆ+pcEv4SMm[ #t}r~{=B]NK 6{r!N1RߢkX73a9"9 BGpbH 6$G'VP qt'KzڸK h25hC`<=D7*q$b52_qn{wKqݯs \9pꗆXVt |͍ r4n o ̎:gs;*ŗ%B*E "Mȗj]G9@75 oWvD 3On_M!BbEw-VġH%͊r(U5()5o吊MKd+vdb|dAr2m#g,5ZRN V,ҝ'AA,OEscz}V@ ULfbwX[φK_tS%HrJt* QRΰ<˷i3o|Շe`B #`Kʮ^%T⻕y5;Cmf53wV,3iMˆl徒9ˋ*'՝zYy1-A-::r_ $+J]f> ].''2 Y31 tW`Ubq&+Mn@i1öɆI b#*ud?2dJPI߲- }=LFXt4nZ'aRCXۅ…M/sF4~@ Wkb$]]^T.TV  PZNMb]]sִ;wF,owVS'U]r/γ*OD70 > S0󉲦 yg)o.T~QzF8;fvb~0rdV2ʨ&n^B! & r)\K~0.ei Md)+?m{ O+T#z>0 {W cEB q(LGANFPGEr /EA}o%CF!I\PJ‚c2U>H[;c#n(X1$pJ:ZtaCF %rNai5̱&֎~ylg8C&nq#y5w:^qj*U<  ݨ 0~qr6*;ɿHJH4 ZY)A^A[By𷒉ޛQg$u/y@da~}4k[#AunR-" )hbyW+ADQɔ mY 1F*e3`xڣ9%xF\~۝,üS_%t7;6{WmYmz3 >4dx<42;~˰r[ʋ v3 JpsO5JN 1;&iTnEݠ,eΧbj ԥ!Ѵ{MJFP7? L"Ln?7@LS|:R WfSW?GS чXD:d}`@p)P9# ^O'lE<O#Dh%<O^OPO]A{c=qG<cwӈt1U<^3GlSF"7[>#WhB=MS;G7q!Lg+M+Z" dzXa۽g~TX&4"}{ =6 Ooib;DS"ڲ_7vٙY=avO}-k8}>9dWptͳo2"n\> ~ .uv$P0 wL0!8>U(eBV".qPk&qc\\ 1pqUGSj෸E2=X NM?b|G1(DBk:gp18בHhw,¬죠q~5!xтOsi ҾG ׀`:"uMfeSvNz8R ( &PHJ#ٔZH5ՋϟDau3Cm(dvcB-fn!,x}8/K! 9AXrf" 3? ܋T qyQu#9.Bc6|tgmx.@Eݗ^NF> Rpl3&)8!k{U:+. _9ȵ-ݨ%uc s^ŞmT^ Q^TR G./LV:EĚVtKqkR u]W0 `..r%QPMl^wJ=rNC%7%5ݦ~&:BuQ&:YɃ!E5˲s1Pn g>Brksq!gը!\67& b[bA%A3g1ps(SxY(AMX)NxK7&Is t Z5A6ÆK7ʼR7lV 1ԟ?rAn)~`nAb;G(:ȎŌ8qD|oE, #%s5$7|,9pA4@ Hk[-X^ГTEU v,;ZL[Vk&;os> X':2WWR=i P2͑52 8ƛf19`mPx# WK^qŵ1KE`*6GIpޅҮ!އ:̿WNBH%)/FdNY#ݎ&Ęlkd ܉'R5mFu":+S1.&h)X+au>-Rq/iMޟ8뚿d'◤A9"W˩nT;jxjQn܍ԖϞV0CwLCD:cy+n2f]9K&1,|'R2S=3K^!E8s9/X: w?^ W [X^R !^2uD>[<.^Q/HtiߊjXͫgfɶW1e0e$"sXz/‰Aze\f"]d! nu^:NPu1K*ZiYPFjbQ^ňS- NW]Kc*-c}5R7 +o Z ״o22=? Āb_ڴsPh_ T%[kY1oCrf8w8{SZ [{a@;۵jaQRG74YZM%!=1̂ K\ B`ƟU0enLn_I6C⢴SU;3_PxS?+*pTmr3U9 U|Զ*9fKʓ1۪D\?QI^1}\?*CW+XZ&-XqE4nEV>U>*RMy2Ӕ}bKEed$,:RzJheߤr:Gm ] qϻ]2h0gwKxI2s4Z,̚:-F|%>&&X$)k ~BDk"#;N\[}@ɻ?(wǻXͷvL5 PVIwD{ AoW/<'~R*|"8%O7y bdUWB.,T+.L?CpX-)^ΜW8+.(O8W)<gE$RO>@[ֻ ɛktH=o`=wvk-7\;kB4L)8Il/EO_ٙʊ/ݕ kOUuk vo|V mw>E`p1dueK+ҀL8 l kԲ'T6Y.~: h݆z)D_~>BOkG?&ނ7-vdyve McH,}kQT!3xˏ4 "r.TlrBhǛOG[So n%J2I !Ob5/ VE 4²O|ʿg < $Ǯ M|.{*2LwǷD~7[͋Xʓ fϸMCjB44CN4+#6Neqy\% \ $DnN ;pvCpcF`;L͐.U.ZسوПraO%rרϙ ŒQY3{+oDC<_唆3crYv:MYw"42"[ٟgD0dEhS+'}$hBpA`#l-!=/Iؖ@H!$D'2 FSL*}*G"~9w&gƥ8Nsi+1_2мO:wh/O>&NZum$l?KEA gGh;=1ZW0\׫7!7)V.P ;Ի9IJVw1T^V7XWg>Q]!~Z9P= =`9!qNOXasՁ 6,J8g'RW{d5$1x.F)mGee醆Yw Bχ49MLy޶ evo[Q珨exg)&J{ V/6xbRft̓ѢV6,6 ;L'y.KuL+="b GG##'ᴑF+VZY -W]T[].Uy5gQ j1IZ1zTă%C>b>CԳC¬8A#%,iPa4Us9.HD &4Y0Ө=lݵx9жnqsxJT\)is`E2YoN8PU*"gnlkY w_s4|~Aջ'lK~g?CMT*jwII[ G;8W9xp#]{X#4g|%ͦΓGI\ ڊgsN Qt^c >[f#w&3̢i0[*Ulr ^9LǾ<bA?uδyyt#]'i~KcVsIIJ?l$c_K=80#x[cgXniu,㘉^ƴѺRzrPZ5Sk=(bjUw|&;L^R0h,atQN*Jʲd.$]Hiܜ-U"xh0y;9W]F/n{Jg<^b o}4k";cZ\"BB\A:NV'oc|\O֧, #/r!MW(k_ 3pQQr84xmOW@z*懲e}4AklLu GY\ K[W۹"h`A\6O BȟPBPŐo]rE#42,;e6 G1{(>[WsBKλ]Akq;S*D2fĶAq;S$ZeYKtgH}[J;,=Hde@3ɢƢiWGKr$RBn6f&P~Pvq_ƿp9Oh) &@6`D3=sF"b{X\ZSĎۉ89&Cc7aPӘo>m.5tJ!P%?r' &YXu&| K>0kA^&ЄLǷЩ}6PN tQa%iAjML-M% \O=`Pt8Ҏ,H(`pjj╗c)i6c`*=iB Ȫd syBBlל:f$5m=|ilX _;5؅y@(Y0ҳʧK+9,J8l&Pž8O}.hPQ Q/V]8!\-1vAYDF|7:67bDYυZڥXZ9 s6 e5]B4n@OUKj/\xWP[Q+8-v=k95M##i&| sYӵcp=M ֋`ڊd=-"a"pA.s8 \d7K0w=V܂8p=`5j-5S\ paY; fڏhi\gП$1Žj (y@UP')}Lb>JtҶx|Z.^IX-?P 눷EA(%c4/{Ђ9c{Z &哚=G#d)\)9&SGX[8P.m2̫r4 2bfT},g/ڑ=ӎk7U`x}?z;z4$Xe I aig)̥"f| 35yx/S3Qf0r+P8ٵx27Ze2𕧆?+ nq[o/B}wӐ *7$o0X3? QS~>(zqēS r<R{Axlyݱf;/Ji qA$$|9|]J@Txԣn3~AArnHE[+wV7}ug߽ByCކ+|9 s`@9C\l2 =z?uY,MO40tiYT &cY{X/'aC/,No 2}he.] =c qP`hDumt+N-" m*}Ka}QxIgKvM< RuG"<a*{xU2GUݫqz .ձn™.c@EϽyhAXuoj/ۣT+a)/#wS+C“d(#1lDoJsθ~cdח5iqJ^q6CMy,WVʠgUpY!L+$c+ ^vR0BjMq|xq"8?JCMDOE#ǸNXW #OL*aduW X!jI落DЋ1B|oҠ.mAҲoO*ny|,n.*z.$Ҍh a{]2:;kg2ħW(kҧ\p ]Z_yRiCs_5tUkŎFZ R]r|'sJƶALpn!Tm d"Ku-uF֮֙j*\a@4BݹEmI B@s-q ]dAȥ?h`T+e co+42E>^W\pN3[5"aLTo(2'ǐ9 )*Ү5'O^Yk.~ I-h 9^d$[9>󺍭0^Ėi݇Mb?ʡ Qh}9|CqT:ϕyI$>R:FEE !($}?EF_Suʲ!A!Y>P`00ps472t "$jT /zʹҍ|`. YDhH(!!_VehSq@zVI# *nx#R+bsY9XC 8Wo`9컍{c/7!o .mŹZWXqSphmKZѺO`cc"}ˠS%wL,}w\F< ɣg^&RE}t|}D)|ty}H ̮ɉgh0f"&%T$*_LXH_kNʱWKrbIt2vHw UPrM̭8srlSpv}9\/$B<"%@3HuEx)_}q1m"BA#8- 11bzBLۋѤR-/C9ǡ\j:vS/O9570!6!lz?Wې40)lwc1I*# sN01!5°sH M!z UL#f9H*H.D# :$I>mh?kaPnP>E>@F\,QtS {!Fɶ_0amxCU1G%іG#(̢ClAPYQL³TJn WqB+LqaLxFZ!,"p)b<~ih?lKQH4䯨U(8: dʌ9 JJ2fǤ9+DbpBXAHLyQ#gEuJ“?T./cb<3bc##&j>@GhS E? dfMLŬxNj-QV%pEv'HRϿJޮlQȒڳBUƕBMV6»v% yTߓ=[wR(C|%$y]JMrq$0s݀TVZX AmiFxPcbsP?˄HfxdCSdUfnHԉV~D8ʃTPcztXDf.h|tqа5:v5@ a@lbx0ɱ##9_ljb_Ǧa$x" i(ߧOK+7!c>~pc L1p{t&!ړ0?) p (A* i ph@Z< @:y`FpdE`Y`/@6 de9N ny^ p@~@A@UP>q"( b(xJ JҠ  **ʠ r$j hZ h: zhFh & h fhh XVh X6 h ؂vh؃8N 8. n ;x'xހ7` > ~@A @@0@((`40`$ b,D8;pApwa`Gp1`  `&)` `f9``\%` \`\V5` \ `|<7Mp mpG#1v')|< %d_k | {|?g  |wO8NxGx O9uT,%%eU<55uӧϜ9DCCLKKrsΥѥg?>!1… 9LLL/^cffgaa)`ee-tR[1;;{˗K988899˹*+yxxxyy\rV@@ঠ`PիW]$"",**"&&*..&!!~IIN))[]222ݲ=rrr{(++ UWWи95}_GGgLWWw\OOoB__`phxdtl|brjzfvnæ㖓Ӷ󎋋CWWG䱛. }㙧s///a0[w? AAAH/!!!_CCC}GP?#""~ +227u1!@">HA9KGOp:!1LbRMRr2mrJٔsiiti3232/d0^cg/(`-(,TXTVT\^\RrJ|7jjkjkjoYW'TW_AZcSHSshsKXKkxk[D[{ɎN[ouutuwvܾ-WO_;*CCjCwwOȈ:t'&'&' & gfgfgMfL-,WVWVWmVl767~s/_B|۷o߿c?bOσ_~!pt|}L"$jjjڏJ*v'VɿQD8uLy@F}tz F٨s1t7G?a.0i\tc&dud~M,;eF9op1s%rFp?Ums%ߍY@WWPD\Q(VhՇ£5pdRD_9͉kߒ(~:IoRRCҒ5222HgrvrS*m W(b?(+*+T2ƫTW{n~_C^QS3SVkm-nݫ%zz7}M#6Tc&&3jf|f4Q-<,, ,X[UY_Nehkkm;nhaC#c# ˺D rMƭ*pA {fo\i[w/͟? $mWCb! R y+X46+0149TXԉ@¡V3h F)Y͍:ơq~gZy$ 11屬q4qĸa IIU{R$RSySӘRө ?33dzfdfgg(tq3h,%}3HzϒN 5dS\uJ*B]wZ3i0'فs&  K_.Ĝ2ǘm_> W/mzZ8U9 \yNx$+)NXB\$atmFY(R(N#%&Qu]!(IHI-K;I?";%'w$!IWᩢ⪒ҸrJ*jZuPF;MoGZZچ#::]buz|PO"GH6F늝*Ý ]nB2{44zfDZޱo~G%PĜ$dƔ)ݩʩfӭdf<+;::'%1 #:j~ktA_zXQb]v{^i`2tQylMEF%seqOj7kk&kjWo:|\]Y!1)Rsy KcDkwr۽vNg|o} CՓrv~/Gouվ~;w ,n e=|t޽+#1#GuGo?}Xq IɼSSlՙY콹+ss/,.L/.-~X2_j_f\9a++}kkصj3M͕-6vG<6xlISm=/v_~Jz oi~o~LJ7C>/*ʷMp|?`OA/_e~3tw8dw~A:>&E)SS))GĨ )>zҙ3hiӊ<t9s t;`cXef\`qaɔi)fq]Z.i\bSeîwYr,-N)v. VnQ&az^!+'>/_%?@ `PUŒ该I=# F-+~J'I$G]-).]:LLGY{97{ 0犞OJ!;**jjKvϴZG):tnJm01d0,7155^17Ś133oPt|ajENlSo+k;bgaCJ'1~g5O8-Mswr@yRxfxqz5z{`_> }$ %ALAHF~ ? &րA?xDoa,1(\YwG_ѦA .Q83;w'^9?A)/Q17I!v ;]i2iҥ;32:2%3۳geKd657\+h(./ZTW,T|DTF9_yuŕJKPQ]]~FY gMi-Gm7 .54674537\liejnЖ؞Бy3.\wJٞ۴ziz%C}'nj vr0f.9n=LGw<9ōuvxf$zr*btY٩9yo 'bRrJՂ5獬,lmonnI}(pc ?yg^Ϟ=wK^YZ~mz雙o'齻^?|gϷH}i*ȷBoQϻ_gA/_y~ga~x0(8Dq?Vc_v"IXP jI[UKn- ](A7үt}Gu2n 92KHy?Hڮb(O4d’#%;Z0G:f#Dp%]+V'P +d>Կ5Q&or\+YǷ|zƃLֺ͎im&IZrr=Ǥhi?Kf亼cLX1i%pRcGZ}=Uh $59!y`IoȤQ{ ،gQIs-Qwf1m_ϵ{$ƍy*Ck˕.p}]+]ꖜntOeشlSKvhI׏V2?J薓- H yWm.B'm1kO&z$l’=M˱HBEquϗ-רxcJ 8Z aly̵%)6=RDRWc?y:#0c4u-{Sf~"6xtĨYP?/-Ӭqb-bzA> p{"pqv{2éœթq4sxϿ"g6e0Aު/'wlԩL -sՈ_RY(M[6s/T^}!90m5md=`Mw\ֻ^ @ګѯ!}*y(+n}4OYU1Y{FjN0E^%9x='a+뤝Tbjy1KwAoHf8K`uJ\otO.7%:k\[U^;FIy8=}v~1}+gŠaKi[ڍ妰bkSGU;W*0U6h=~tNxln_EŔՂ7޲`ieMZLw*dNzEXTEzSī4?sOSVK3wU>w稷>yM_9D\89xs!K u9oKP5\!=p̮uKgKg5dGҷQg)]ڴqO(n~ TI>-s2?@[1|%z)`JH+LZ܌FzsSYe߿x^9a.e w_ DTPinDn钒Z%waݝsGsټ5sd\ ?shigQ50A8R<(3=_Ru0VVn(.#P;-kRu*OrZi̶؋b fdG9n 8Ȑ?y5וx;!6y Be>TV'8ja73pȹ\xPѴS5PUɿd|E1vDC#sOs`ᙎ]kKk}iV-+F: t"99 H \zvX37s V)Fᩄ0[`3%wܳr J璝7cªQQjP']lQԪݹʘ\)2,ѫ%" ДĊ{&qK` /K=mC%m/2z E=^}$9n Aϑ*C*qXL{pۜso=8zVhtyO~zF.KJ JX -bsR)z'C,>?de7mjOeoAC @Ƃ`7RsR6Vds Z[;MӉFͱo'GVM>یJ ;#$w]s 5s<+A&ڶ$jbv@EAұبj;r۟ @k#X'>};WR1PXTo:4<>W4+eX#H\NqRJ:<.F_ZFᙏ^ ˘ #=d!u`T~`Ƽ+0o<ʿhz֒PS]c-R˗u* R¶Q7 \FF.Rc.Py2-? ϡ!NK?^,sg;O_x }rzp2*@9t}(R_b|7:e  hZ5U0|C zevTGn{-W^`@#(1z(j i79~T%78xn)ᖵ">zp/9hWo_ lxڷ[Ne ͡QE&ꜵ4tQĖm8(>kNMS48$$R\Q WbJ/#S",On/ j7#3fOđkxG,iҟ=ܶ않U.ǩ W(Am^E:0/gkʗ͢fmf=<&{!yLe>C]6Β4)~la1)]V!;QmRfm0V9ߤ_SL>z;XN~/\6bf@,7R\<h̥G݆`lG-3T ~thgp',;?Zg3kU9>^zo&b O4TKr_~c5W)r7]m5:ϊ~8׎)& 6U)pF:|\ FU?A_awʯt,#t8Wdأco(y|`;aOMPUd(a\Qy9~z%~(x ޫVFwG'زoW-:,AdxV~<yzo>zCE'r5酂hI 4p.V첃k1gja^kG^iPƤ\Ɣ^;5!#`cjyJCs]dCboHƢTjZ-o盿rޓc.5aS%d|iL1Ff-lU|"eke7ޑqB/Ŭf3s8tlJEȊ pWk!v%!q%qOԻxun^:Eq9pȪxF1l‘v~$ß.9ֳ%*VFSJps넂BOX=:jé`<1.J0c _q(鐂\M>y=0KvEb{c^+taHBk"^]jFŨy/Dy5}1GZV<4%T89 y8M'r}Kl]EuCb٢aNM|9.O @ֈGZ< R]e7e:Ҩ`lѭ(GvlzQNjv?Vbk@1sY@YbJP SH')B<.D<72n-s *W̃tPh,]pt4qMnôT$kL~Uͮ$F_P/,aXwMִQ̝L% kkOGwVt`ӻ .a0ޔE3 ,j8J [KbƹPڢ$7+wdҖ4sz;p-ݑ@y|}(B/Ah*'K0A^g?jbEJHgUUx-B;~,Ke.gLN_;1y%+c~<uA@^ 5Oi`](0A_XlLY`yXn [F!WJc@I `_ûfv FYkMfjt |ii-6sֹ mleT1tZe}r\eyO&o۫ΜX,I]AZƾ/za˻R*:P/ێlwW;Ѧzpx{h"@h=Ixg$7;XV`C/PrlvM=@g  O)湐$Y[OC*,tq;ݑ8ey!T5iUZт#Y1E=)ſ3WsHZֳ2^nR\*wƧjD?iˀ?8e/X<`B{cmn @q&{BD" v{Ii.)#u03ABM* f'eT=Xbh? | U^x7u}%b\c%)\uzh>z\<^qf篚⧙[V2S/,OO9kƘɋ)dW31XStg* %qc)!bw\rsee|iGi|&Xy}v0R1GM XXdR^Y1{.LLZ&YK@$Ǒ:&D5ɍ Y_w `\ ty|7Kqӕ`ߡ?G?5?XYn g(in \)pY[=aneCt5CG pũ1TÇJ `?ʌՇ qq@V7د ڔ,8[|M#wv{.mPsSAiL3XNҐR6〸86Ȍߝ74+Rr/vKV0E]88 mg=5\L&SdxbzLz:]2u)ߊVbe E޽&03({=?䡅2 y:L ?sSG"XNwƛ7x^h p_3qyk٥S^22!D v_̴lrC[ih~_FVZlj硆9;9,cTh?@A;) NM5kN57f)UHj]~wFzN/;Yxe==wJG,?EW&̺ [)7S]BڹkE^͸rYc{K[j]sIl4;@Y 5orh'뎏^R]zp/?$!"x豖z9î0P^"c>Eg;s)9g3 '%g>R.SUͳh?kp2!mv]6İtqYhbf5͓4pj u >tL) ; ֨6{9_ ! ݂`*Ȍ wqcsvlY߽ ^!x0/bTj*:yժM'' jp2jwF#V˥qz}\|Z8Zg{2<7IaKĎEcj!;a倉 fC=Do0NÁ&MWj;G.t`&ZP'ґ B`Ug90hSljӃ+!c6e*furtĞ:{uJn@DTkԕisȺ~a 7 ODgN䫍 쇇[ >d9v eBɿ6oN0|1^g 9dԵG?ײ<|B(u%Rʁhrt:{95ohVՀB k`:>XTdF45uo}lr]DnR.Z4Yr%F@4q܆j֭ޣ |~GU+) ӶeƼ>J83Asx^rki[z Ol`Q̇w1!Ld#: N5kzC/v ӆ?: ? Q R`!eV E+6!K|a[0X;IZK-+Avp$fZ~>S%&Hgȩ@{qa-wŦS4AH*raBf58m>\m0t1xSʝ4±y48l3уh-k0'Y01K/vCR5-} &^o2ܯԂoh00<"8`:>Rt4w\Dy`qj >XV̖0:Z{5ˢ&%+{+=k'ImNp(pvi3bKوJj7d q}VT;MfᵡKu;FY_%Ot@V4%8X*z̹ r4b(cG l'ųk\4Wv>)2=p"eju}fZU%:̮2 rnK7PˤxqxKYpz(|Ѹjy,{hxFqf5S/L2E9|澬w=د<&"keo\?'T0rǼp0\S.iv+}/8Yw6F`\`oy7XJ'ݻ CĞf_lҟѫ4i1׾,5)VЩ9[vd^ZA鲾XQaK y9oaڞbpO?x> B̟6=n}YI_`x\q)Gl|Ra1*FN3kރWqpq[h[(HHXDJ2r.Vsx^!!ΎNɬ䍹%5ZAPSHZL&kF}rM?[KqIP[6:&,enh=Pȏ&!?NZ-&mOgHMys|P `fv`T# E6|H ݹ-4-@7(ZDR=ʊfFqq#rESRu[#*H~ jdg8NĶ~8߳7F> M׷H"Kܣwsw[2(C!!awhΒG2a6]Ոm+fUeoa*d,•mvql-)8~I#sDy|x`as!0>AU o;˾o^I,V۾~9iݵ:g:TC¾~2R?JDtFK&8$L$;⟽k :nQ#nX/[<0}xP{~dkЅw 1kQ?s6=!q7GٹQ z7p0VK{+ 'd2)E'o_XSO" pL =&F?/Dݬc5P8mڑiqG9(;Q6n?١z(M r=Ðt+PпOjvڇKD3g`dXq/ɞ#F5-fm[sHs`_N+K@@nEVe`f\)ӓ&N142; l@ rE Z|_Ea +zQ{^&ljn)vpB(uGzG;5T;I *|\Yi PxcϡI ρy+qX4#eѸdĨ6ѱjT\4+B#{25BLCw8 pxxjqWIiB|SBwr։ZsuzU*zZ!nUxЋQ=55cU^8U2+(& ON -eFc949s,2E! hhx?tđ wɂ<:@py7_C<FgJ}BHĄU6Dy{qxX6k F.Zb:W]kv1 =S˼aF 4F*r[ɷҝ gg"r븳|}+!ٸg:z9D9.:_Qv\=ϼnp`⛯ 2mzF" 'nA.wVm*B<& z\܀P<Of۠A9Q%bY*UL0=o)_qK|9#MA>>}ltM%wꖉ]GoisuQ\,y~'/D/ɆA4EC*g@QT&M9gW"T;W6t(l ς%.%)RX2|ӹ`US(,MARe7^)z+-Zq*E7V`@aoNVYsIfm<?2[97߿tnplg̪Xx.ȎM4OդήiF$ФJh{`'1 )f3QdSNg5/.}X4qN%@Ɑ8(SV-v*fmuH+X(-iu?7b,B'm!۞EiF-ph_6U9vTXR|T"@b']eO F?H~= 1>ooq낅 $ `ۚ*f c[5&4l6||lO;Hp:d=s<~ :Yc0PU-wfeNcn0%~TڀgWoq?v&YT;YN|!@vg$ΣjJN;֓=MԎKx}_(/*ku0GA.S?K#0cYYex,󑘇:l![$6+(wvZ\&zOM(cKn981}1oԕM$(x*WH==@0^ٻjU]JȓR'#VHe^]wL7k4婁XIcÞ)t4#mHGg#Cn+zU :[NZ,ݑFVz(Y%Ԟ1 @ܠ+.o؋r&#eP+Nu{ L^VMC!&6ԉAxabl'Uf7̐5O~0ӇLdqs2A]'+!ƵtYDz'qfo-EvCy {?^}eEXZidcٕ*Rp] cfN(f()lǾe>,nPj.c4 Ƃ xmK7XW9vlݱZ@F2) s3}DU\G~أE?s?xfb."V`@zGBн[-EHƁ;e2ڲe݊;ϡJXv,ߥ$8G9,t*`.eH ŎJ|1 n^+:;}ǗNaqkNwK}(+z_B!m\1Iݡ6;RM+{5) ~Zy+@Bzd&^uX,=]}BaRbE>Y:ZZ d3 %oE@~"͹ gw3ө ־ /FWB|WYw-\y5/s9O`,/qXLE߀VP=wuʳNR|ń 2\Xf+SMBJy$j}q# WE{9󨰞h[ O7ƉJ WRe"pŇIrT&*e[v)]%Id'P)ݾfDrv#;3eJ|Q|}AƟI?Z/M OU;nMݰIHk0#G#.6` G] ǚN='`n^Bu,V2ASRɲo}PL6u-oc 0ޔkz&"O6'c_cFg-dv!<T@jS>=Cq!cN}ͧw g/O9灍LěW]!Ve@ WLg &GV-#xYq:Að;uȆ!ƪ iD-UT\Gy2yѺcZ}$6u?Cw* qgCվ_[؁dq2p홵б\x6?y6Mşۯ2xwoF:`l v:丗u>m%ef<Uӛ@.tCqJo ղm+#G; e>#+ď}Q(a^t^ KQGqxцιz:|ye;Zu4rj{qaڊݎ. \vZOl[-ϳMJ!:)oxg/ ?hv`|QUHLpUuaLH(NОIM%OW(ҳЙ"iY1ʋ6"ƂnQb!tWm툃g̰Ro?ĩ7ᖗ/-C7;W|pp7~tm`W=w(G|o5v(QXo? %sooKMj`dIL X^g~':Mqe00hkElèȒ}DP^?]ިpOYnЀStza)sۣb:ۢnJ'K2)#x+ muYAx,j6=p&8'y,KNv{ Z+/#0 ӒoY(|5sJJ}g !%祒cDHzs8+$3x̥վ;jϼk?k]%:qs8tPuSQkCn:>}lQ6~dstPWG+_/L;%ؤG(Hi8՛US#3j~|w ǏoY^x=HHGHoqcnoz |bzoܹeu+:;1?=WVRVÿM3qd"W{ӂ(qt`ECj޹n@vɄ9PHӅ*DTOťuPWع{$@ˣcbOn p Xi rqs,7w^L%5E3@}F/FXҢtG7v b٪zM䮰aÐ8A1bvK]D( 0l <E57Trx D/-O,e*0R\RezXvăO$%v=Wqk͆ j>|j=}`ҧrY: `- cJL/Q]O.?^u̜uRwBρђ|+?-(},Wt~rb|>qxceZ_!eӸ!eW_%V29rC2ت_Kg?umoBw] ^/Чv=g54Qkh)=UɤMht(l[iK#q3٪JҊRQI .Is]laisU`5㘳olѭk\׈G@ pI>'- , Z8Y(D-!Rg.WKRu*iV˔<7 X$(WND.J ԁյℼ`mQ؏o~"i?`,G.f$|}Zk[؉'o/"^E5,uk]Gy7^^ #Y͎zWOn_9X+_zW'"e[3P>D!WH@S4%m$dII'(ZB" (lm6_s%]gnYmЏ\>j2hv܀ֱ nTX !/m`Qc 0fL?(%fTT-A̫IpY@6cS($a;ˊyRGYE|}|A %{IQ)QQDDQ"v<ϫsͻwΜ F 0cX^BzvD7w77VclGl/ƚ 4QTzM.;HLlmGӴ(BGÚՄ$?LZhMJ/?0L$=AW;S0^C5Ԓ7LZ RIޙ4=?B)OAeŸ0z 9fDHEH¤K:M2'ץLfW &$s'8gQYܬKx#kLLei-{B#۽6+Yݜd`0Έs53 ^\f{|B+IJ+;'ÔBGeƇ> o'I TLxw~U 勿/BIIK?/VO]t[N~:owg3'h:e섆iφ7x'Ko4 Xn'jEGup!sȎe˓_ԏ7դ7ᖈv2L QZt!9K]`>L3ޣTYA0-[;܄AdF:(`ؕ%{1BѰ#ݸ~zXL=&O Pőxo!}F X/q4,cV2tSq6Cu]e<yml:'`^Gj &㸻AWߐ :q6svKngU*Dxaۥ VVz1aem+#lаV6r9f$3HJ{ Gi[a7Yٵ=>m_8%P #wɽvN_"ϐmy?z֪G3?% ڧp/&{-0OjyaWF,+%:/l-ENH O LiCY|S1<6?mbjv([_Ǘ:[|wwXMOh&!iaՆ< fХ1)S Wu+AKgJЍ&Xθ&4,J0S< zٟJ}xʩ:7yWBfȹ&1.ĸ˨ьOqIBKr/4ɽ_ɺ?r%ǯgO#Z6Qu9<V0Yg_!֍*672b#:[SoSE X1n7=2ۥ:Ձ,ٝJ0bҽat԰]?װXqQ*%*rI,c?Gxθt2dڪz³VA3&f\M Cp-œMdSP<.Tߍ"У7M3񿦆JlŅޫ.eY6QB垷&ZpIi}&ao4WFM{;B5bߙw"mwL}g-aMp֏ʖ-x&^X^=X[GL`?m翕 p悑0zPYj9RϥG>mpU?e['7FR{S=$\?0YP/ȷXb'qJ6zimX"VLVX4`[>&m@m~ex'60R}? Ҵ]`'Q}Uvb*V_eY0΅۹6v_Qd=lGa1E -"\{j,Ccu q[[ ū% N) {ƾ s{բ h WA^T[[ܾ+vîx'8 f `Rq5_~۵iXyw!-.S8W̴5OnZ(n+ay-er\nqszܳptۏxR^>{aAK22Py iVdF׿FnO^ꚨm峭A^s-;Kr[Xyoбi9yVhΗ򽇩/Q[Qaz5|sZfj5A[a/u(xI=LMkt\GE"iÃ+?˲ҧ-:>Ѹ 8Pf leRȸf@nmxG){".\`M0C&0O;grWUAF0H3ݶdYJçnu)gM`;0;vbpG_*Lx0Σyg{zŸ?M6Y_g<8 6R)&T^: bBN~gx gܬ܋~0xQJtrϏ7h1á/@ϒ+!^AM, fȬvڵGe_@;!TҋFP[w~vs'ۮq뭬9d˄Ȑ;LpUnZMh?gƪ ( `^ wK=OަFZI7wGM2`7 Ty%ٵ-y79SbuR#sh$ApLtzC<kJ=ܚ@ cMRЬo \ǎ$ݷEmA)%0A*I67/a)Z}o͖QL3aNk}͞ueQ|]H@Ophd q 3#@qYu$0] A?gso 4e-$㠉3i8iU5URwAn?ݞK"ЁFB?Wg)ArPe7/xb |!UCfpw7 iw/mUrx(zc"zRI4/-KfODsO DGvӈ+&р"赙t"ɬ^s4BđLQM6ʞXph8ZwEX8FvN{,9ƞG^UgemHfw6"r;E鶒{ {|̤u5hs~Mk~E8hiADYJ1LKK$Qo OFD鍘Dhq$CҰaoPxpvR<$u"66MBOlPD7"!#g(R":eJ9ti9@bC.|K^2za3],u EGcjYH2x)wMtwa}Mk@V5ވ^B`lU!J2yU`>C[Ɇ-yRB9K4zMFA !9m #>IiMhy*Glţʁȥy-E?dՇ`ggEzwu0CSrBV̴ifZ85<+1h_S$>حGλD+ Ks*y'C+#j{Uzw:|qCQEB"T Q#s%%{F`vKQ8?zLR/ĸ *O`1Eg0N@#dNvEq?LfV&,n olCPy4RRt,M=7ܴ[%uW3+}fs[|[9U@ˡ'nD8=&ي~&TwiBe{CKWpqI*:YKP(Hш;k}Gq-5¾^,+3 t>8sX  [t2hfa/L[?G'Cys,+S ]fu1zNG\ٜ€O`iBVW&nF_ܾlke1"h4oQ!ӬA6}E|ͩq~:%.9ޟhKtF. XT%_TT5A_)Zw"E6;ØUL +}/͞j\s ?Ŝw )7G}nv68o_[T\̷&_7YǘxMbkJmƆVelZJs^_{F?a)!&:))xǢ dpT `7 Q0z CHGw>+K%v/C$ѫZL0$og4ɮ3K!$%ս]KFeXvmZ_=1cƸ.CzqEhϸ|%O?-B9wI?{ /`1?#*`f*&X]a ewҽEWvVn0:'&8#t2:fC$[\zB(oxo= f\/6}B+Y+L]w u2S1V1acVߗFA,];&(\-m^oڧA8eOch;hZuƥ;0?#e4B'Pz/ע0I!i!DI'0ZjGlUC2Z1D&Be&ҊcPcBIˁYyGշ#BϘU L14δl8S{/yv o+e<2*OG^ke{o'<$8[GO:jy/X[D1^ aP H`}mDÀ⫆B:ͬ0/eGN' l"?]T+ sgkQ76 טdrvzשݷG: eK֕ã}`>|X0Ͼ314cqv7%6ypS`ړ *m'|E&3|L"ᚢ+CoĊEE_ @r <ܘH0샪~~+<)o2Ř[-o mze.`nͤˡ6h ^EohMr(r(ܬi' ղ8` ,]Qބn5 ϙ(z2 ZС2Ajm>礟6GfȰ&p*R }q8!P43e?jcVAepHg矕wϷD8]_H80jӽ˳;!Ȃ1ESo𢡊c0ֆ4?jyGKp2Wت s,,5_F׫U0>kY}\ahMXLz+z f5Տ1j_`YM xDrW7k/mj|1!` 4Px\V>M){mjh7 b Zڎ +&T!ɻL02=bX5w|;K:v;ધ~Y K:BG^HXOƝ0[ݦ ^;8PT¬ eD CD.߃AvCb?X(}2;oHx_csXlLۓKg3Χ=mtb^6v6j?s<4%ENE6n?Wur1n _O\=/5M4J;8L\t(3{~<nKs9+@dy2lXO̾ ʌUΒ5n( O/xYǙntvpRr\%M, g r&sW8:HyS16T۔NV϶ Cw* v+̘/}=L 0Kga{.+Ѳh0c,_;cp>؛zJ)XsLT1tlR6pr[EMݚM *PbK/-WW&FDn|/ htNWՑ_<}r=Zf,K{WF\Ӱ@>N$~qega+,kఅdzzujKM|gۅaYmr `O2^qwFxK0r`!$~)Ɩ>ɇZ݉|rp >| up =+ }1#b5Vg_qbBԆsy=Ǻ}q`k^v%}Cgc#O8?%K L)uv7lQQ\`óP}=<gT5t2ЗP,R t2B'uɎhRkO&~otnW'4uz&80ʻ*b~d^~%MH 0-sC°R{o_[x/T|5 FO:ÜLbZ%WK$@p xCq6|;ACR|}]lz'^_Ҋ?kRB>amYFcA%kL9{,&ޭPhfw*佸w԰_=ޯNϤUlGש;>8ajKE ԍL>Q]:hahGd PR6K\6 b`}`Eަ/TK<㞩[MN@[QfS:o[81r}+2y۞WL tGGm g,оc*09qkaƙ8b})5^^11[jA V1IOyɞ<`D2{{4Ea@/8 '#:?((Q\Pvc5 l9$g3Bj]N=ar!i=œ Dkj s B3iĆKӁ#YY_ٞ2i=_$g:GA"oԑϘ}"?"?@:A]y53XOae?qH HShxy pm߃Verv6iiH *5|+? I˩%b`ef]-sa05?#X}=ۡ%mA9-u=gC~y a!w6yΰc}1Cq|g![@|u"n!+?!Lh Zjo7 M|qhѯ4Tx^/5U~QS6U*T l΅k,ܼz >{uDոnUCϷT }L7{m Er$b7yW֛4oyI}/"+Õ#d}!r86A5]0yΐ, = iFAPlxRWQU1r#)e\L6OXxH8.?÷>~KZ0r\J\ncU>Y pJeSo_ .nܼ# 1iB an=?B1= zO+\y}GQ[,o*CɤD+4FvPIԆJI:#$j dy@W8|z|ȕ|!Pl(r3,O,Șq߭lY)PLT9x 'oa{0lo= Q=WD`*Lp)C7: }Y(x́$B:L$M0(CkW8qlT|B-hxRf$ [;1*SuG+;>mM/6{?g<5jmB=]jCڧ'CUwjTb*`'|#SXHX' S$v/Vrn3;C T0u uQQ\3s90#- ߒnH&[~fIoѼS̸h4\#~sD&4ip ~U7Ss`GAUPF}_׼a" 9|^|/ su[YEK;Ei5Quo% a04hT_K h{SKtfIOK; ./Y?CGI/a|Qsd^<Ьy0f*}SbOг*\j_@ ѥZ{tL0xE~o:i!omazt'acvW%4`ؚS0ts@_S6WIh4Ą)ፊ.lyxߡp}2vަLL$f9^ jpN#uim>k-Vh͌~1kR陈V0\>y)a5W9uٹj$g,ʭ0'Ѥ!<&)uCuf60Γi-ՄB/$43 qF݃Ғw2Di/~=%e=Ql"qFd-ibk=ȐmuMӧ}]l}O[_mi\"t=h!'fvK> W y|g&=YJ`V6T4G`1c=^,Ev0!.c2OZP;Xܱ R0 4Z" R^$do.n>1$o.cdLGvG&ɡ嬞M :ݴYkf6VMDŲ$|,yxcqe"φS}|D u.9~{@jSJV ,kG }Gn8?n5<9<K?a#- y`$3Q ff1Cffm{xW.0

|X__2͙M|S lao*xzļ>z=r٩wY+)Ə4#]֣ Ro7b ۮ'`).{]Q}9桷-+6=U:HƽAP Iب~&Wm} Lm0Y:(fiܜg$/ ֛\iMkY7u'oqyyHKO~ʛk".X4iw$ DlNċmg{;E1 BxW1L>ݺX1^]}aKR=qNm9jΐߕT>XzQD+) k.th§F0tb*C%!/-Iei;6Oͥe[[/}~?Qfs0w5z yàˮv5_mY4)7)R ݽ:ܰc2li{':N}w;kط'Yau 98X}NǨN^%'ߓ`IrlWxįekA4ľ(oV4惇M!ϭ 9N;,<[0 |Ț^fxc}[t0̖d{/puJZ,j(CL%A |rB1F=m%8F9FWyxgE]o"u!r0DuO2q~NlH?紪yq v;A\;{aRp>c ۵VʱEn'5%!)K^H$L8+V5ZB ̚- kL,^<:mrxqq v[%aR|Psm#N"hV?Fz9c/~ Ai ,m ND9DPkhMO"ytZ|qVŨa2WVe fJNg#tܖ;?_l "Cdd#<l9ptK72KٝTStgE݃o fX O~?=1_  +9ݿpD4l""G"R0tq,S3!\[5EdxЫLS7ѶH~q4߬L1(5 | t&jdRWxy+th-ͥ= O{ {7 /B liE#>M2V!n! +W^#^R4gnQ/f^S,tգ~I\wn"GE`J[4Ue{5-B*M# e@V݌?/k5t⌦ÍMH9`2Qu@Km Y̿!c SX~NpɆ U1'WDGMfMw@?B)^n-4=RT1[Wwuoúe;AKY*HZAcԼAL5etY_⋄eş< ,Ι 1^7|ҺJ i0gyZ.3=Z^KT:{1Wf,xmO~c}\xZYhi~^J(.XD5;$ג_B|BO^hT{`UwrWK{sj>wl' 4#`D{FȂD$/ja[]*i]PQ.7Pwkm(MҮ~k+/9êe'jU} ?\un.̶@yH֔<گM"HbU)~؈>}^c /ä;vˁR> v~h*@qڝ/0`&~;F?%P<ԐfЁ} 6N ٚ#4s~\oVN +-,$ƙikT7VuUٽa>rpꯦI ]dіO_2۾[>h5{ H9QUnF2fzaO^{ / gtX,>Dnh}iGB> mo{03²qU&ͱάa%QCci߇ZA3hrb(VłؠϪLLTLעDM  slz&eXIːw c%X,$XUxvf0a dsS2aA'dClh+s| {Ou,/Á+oA9FG<|7 _or{x)E\z^dڗ?#j75,Uj Պ>S.#Jhw+ۓ p1 >>XIfS?򭗙a$uNUq%`6 |0h)VNn S&l`œaOQh`h=O %o`_wdH6my6x4fŚ,gVR&^kQe;nHTqug*ZmBeĒȴaGa*鵛0֯& }E}u{[ 1-!/<a@ЦGuFk6@ ZIegȰ_#tTe}dIiYf2{_2kZ=bVԡSZͯjlЬq%]t 0Ԧ( ڬjߡϫs}CcE*;hSe&-e݃è tm$aOGcc?/=_[6kص3gھ;8*`"TOvN{ofIj8ga2P\n?kA}^ZzAn5rN8#tZ0( *ײƠ߷ }8rLB'K1,MayZQTcMJPЮ԰S=9%2VQTwB瑖,kA[:fww51}K?0c_yuxS[z{2m+CZyjo-²pZc|&>wRx7%,e<8#, SyiTQ0%pL)دg&a'gCh).0jլǕ!9 ^IW/]"Hww1zNA@ *vSvtw6= ϶ˇy9={{fދ/>Ӊ)"p%{n+0wr@xޙ]5;Cٷ OH'oi7znI{ӊ"x=C^ZO wUs+$5 gEn-̱{0gLM7|K{ .6CS/ki܅ᒇ܂!L X$%ÅR g뤵H=e= yCW}XWef7{hd28ę462)#|8QϹm?>ޝ=4aTj~1ӫw.=۳Wrw݂+ݽt!9W_꯸R/IjK=ǽxiϢ.<᱅Vqiw1s]x.9I ,/x"mFy /*ZCˁE)߃|^֧jKx/(_w-F'%j2Ou޹5;ϡ6T<[iz}F&L>/>u1&t&!ٰ9_9A vY=eP7$ieQ߆zgP?E~bZ{+u3yoc7.FM~vZX//pK/ A]]JŸ]9gxTd)oFS9'~˟%˺V]踤Fm?wu"CYSqG9ۈ3Om;||^-"xvF*l[˰InJ\NH28BOxPv"b@>\;ICUܘ 7 XOo6^w8Q1AXh"I7Ct"Wg׼߶f)ij%^U Y*MxcI_gWgz}aG-~q!*տx6] Tfң$f@F5;A6N1̈́+ +-b󓘃 i3f5GNj {\-cwjknפrMH|8[~;iP=ZovL)VsqgQ>־>bq6P]n1bXyeD2jy"ʛS#Gn͌{L}9ytŶ AA|h! ?K 8OLpf\QRb _+G T{*ӐrY@`}z 3N!Il}+*}eF#|B%+,pvK[VqCxhm5BmEgާ&љKuVѶ`C٩B'4YzJd2=5N9nuyogW}t~cj3[H[1 Ne_V#.)ZאAk~#ϧL'9$vt@T2f mV*GF­P+l044*N\LD`so:JQD,0W8hGI+_BNUL/cڀ)$g+8\݃3+'n&mbK+{wk]Igm:!v~H}X>:vXqtnܧux>^!V<70ƛU텽9d! 84|l٣ SʻwfOp.8 0l@)^!IQF,Kc_h[ VO ^DP7BD>-#<,]WVؿm"em+Oab5VFMUItb7s$s'9x{uyLu)Mc:TLSx G m*ē [LQ91F;neG^H) +=( "V8$7xD me4w15,M_ì0Y?r?DLOyp‚H j*t5xjECq8{j [ NvuOto|}EP򶿡"/ƶape,韜\Ey#W2 ";  Aà +Vߥ ^U&(b?ylݹ~4b`pQ@n?>O; % O}ˆB&:n0FuPzfc 8Ƌ7z T34^y}_5`:-TĬJ"Fv7e!m^EY86Hk0II(ia AbC`(#[oEҾͮϯJװ0|j:+! ?5*'$NˣJPN.U w&z8h{j)T`Lc܀f _50}#'*`xbA >ˎ`& gNΆ%Wl5`MO\g6'cX7qCT#\-ف5~Za]XFp$7 ; LYI+s9xhD~4g/ѯ)=[jND~'hu`dd ?ۊ2*1Y*b,;^)Z)AZUe;tG-)XU{tO-HHcAߜl" *+y@ {ok!mr]Cٸ*Y:Dj%)B5mlr\vlEWreCW̽Th(YauzB0da7T O[` LovY_LyYAbo,u^{0~XXN$9/@P يL ˩T t9-!)M8;0n< VNX;aWOW'h4@\/) Ix<na1*B-'nء+}V4ASbÜڬ `W%{08 s_(XBD* ƙam"b1!vᯝ ÍÌE 0i,+i=62V]0+8|WbMSF贀 znyc8 )N9?)Y'NٕVLJloV][-kXĖߛ,YsDyo/ss7:mA*%_t@GG0EQXov owqW#3-pA0f֙+ֻst4_9G>N[V]&cV?nw2>ͻRHofW܌&8b~59CK2Q>6"F˝#I](bVdjcՓ mY`nCpRƒ a |T'q3 lTP3/U+$Mhp\q]stpLfQ|āek}ݪ}`w8LHpҵ>8=|Y_|"9`UP%isV>{%ETLm,jU}}b{F&5/ۇ=U`1dR ("] ь0W<Gؠ{R_,= nGp=*m4>o}iOƢv#_- eۻ"m?Q -Gy Rt{Dmis/=JY<;ۭxyE?YwU=bSêON`z*u>w5av1vT3tk}DqbTS<h; _}U!J0n=^V2܂GA +} WfL_X|҇Fmfo=g/Uq1F ϖS[ /y}eNx{p/0!۟CP Ѭ؍"Л'2DDNIM2 m;O~SG3!Va0]!6L/[}/=&6/v}4dgP|?^n58cT7|,%vxNP_hHȤEG]pI?z͵>}B[. 9Gqcpv]aGs-lyaGn0qPzNY wmRnסcE5%о`wm4t~{|wve혽ԟQ9t1mMi YBugR^fɖ ~:ɸ1xkiwR)u82_C#75'|<֝^Һ3u:Xf[4x>&wlg`xFZ;gAlA%n7)L?Gဉޯ`t?T3{ :W 3]);Ѩw_I}}3/nyu9l#!?r! wAدʝs܇BI˜FK?G@ ې0X9|ϗÈz5Ggqo#eA  /O$BILP_x1ѷ_4y7}tu.ylʾН;6;\s})ϫe'>o#wrqGFN=̥Ïz- :#};-%l45m[$DLAO ;u5r(X< 7p_Nv[[0{#,zDخ #HIQ΃"Hn1\vqiMvQZjwk Y?[ł/shRKN\%x ScQ+6?@#GG9~6(jBc7Oȭw ! ۿ3Cm2^`>p+ϡjf[3F_=mZ{QA:g7FMk7Ǧ7#F4oVC5so~vcPlD˜jwVut?>8[~^[6wmwqӵ+-!PO\6llQ e=ibg'qmVo^8n#(/tnsY$@E]rItvԛ㌥CgOVep$f9ig;l~J>b!3g^9g`PX5j-D{ B.v3Z-nDi _Goa: `> (d+D]>沘34HuY6ۅ pϟuM-c38*GsM*[DKj3ݶ( Yzdp P1 }bsNsvņ<^~r)AM)sb G%NDˆOVҹ*^{}sJdnW mM}SG/ |Us1wn;X\FҢVZy>h?9`wf+D/>Fd}6Ç&KQGB-#A4TD]Y7rW8|*"%nf'x5s5/f*Gxq ύ[5A2LCs:F^C8d"5 ɖ[S౫mxf^#`}3Nhj)J0յJ[ug1V -Mܥm0]f4 %Lϰh;o)g aK>!Ɗ1"0|F{\!PjKaՕ]T_&mp.0n$۬ Tjacu㵦aDG366خA40yʐ lA$Po;+(l _h=3Kl]݄-02ygݘ2I`-L7D0*a v裮; `k^ad\p^*1$rCu&my%N(0IPVNרq|zV/ڈncW"ln9Zbٶ1,isO1b'q/E5Wﶁh)2o@MsMY?O`:LYFD<Ojَgm 10B"y҄-p@`Hj̸ oP+  y6ɐ2tU|f{霁^ZB۪ZCifGl1%hZxbqz#f`4'?g"?`%9~HFA'?R4lqe` OdYex!3$.vJza/]af: 0hJV-2@o~k%kqwNWr)r$M?78逯TR訑3X[WxV:XtL=嵴XjKB3yr,[ zoaֲy :ҍ:b@A(Fq 3⒟a뢰Z59֧KX&, a 2/.zCLn4 NXwJ _gUkՉǮ }8}1oKYtHfuYX$M&Vp`uo"~`}2s%FeU}9@pdaq}h75nv|pT9 ÈCh:N la.eCJyt:蝰Fյ riNf祎bye>I,?;,؄:{1cN690guY'&\Q5\![!V*ˉ9δp #0dKB9-.Β2zlP˸/uh9{U7zɬ≵ԍViX9 YjANgDX 0]0NTi46_pAԠ tQ*-_[m9%”A/,6py@rU┈ⵗr]=` gՕ(/h'f7ݫGj-Yf8bu[7<3tgXWoyC7.ڷ$GXRfRDZ H:ϝ.f`͘ Cnܢ 5 gQ)+SYA_i49&̥W P+{Ή9u8.sJTL/.jPU,3}}vV\sx伺2ZL]Ts'|y˩YYrcwNֱEfQ.~o9GQ;7j$@CnbKX}l~ov_)0zwslMW=>.u8et)%_od}i:n睮f͡!ʗeAC7^3|/v_- +|8DO\,ϰNl1=[D6N0Y,3mHFJ:ЛVor`#R47NᎏF}6/)ʾD?܃& ׄhp^lz߻ti(5oԪ˅<ЂnBC{)U7R1d}H82*甆ry2u@ eh~Qݿ9`>=[G ?d`",(%EiM/Z17H9mL@uчέەYoNxV,Jv.j ;2^͈SK_N򡾌(݈RLvkKqpK ܒ>JׇVꕿX)2̹ l_`~Fܰpz$_[Wp㨯FdgYvA} bv-F_z#>K䓷l8_Ko4#=On=4abZIۅRck$EP= | E&rFÈ>q<˭"}x}GsBi "S dהe\SGեR ~z9zeMGӷB~:To_ڕ=m~`rAyAu7PӹWJ˂S^h{H+ 1:ԺQ;iE#RR,{FO^> mRXpԁ޲q0aG>zv/"`ݞX{=_RAF4٩ 1>!6g$Fԇ׾#:j$Z߳,夂@O0=Se Hϖ{dU/}'6ND_|M 9IW*pc+NuA{V{ڹw%Ƴ(ǩ_[\tem=4>:i~ni͠9#FYk7n ͯr Ci7,c׵Dθ1"Q.}قjv[kkLmvj8G7a{ףM~?(wVorvUooH9A{|z%L&;^2r|ssQ=!/h\A<py!HVTd#];oG? )HIV#R=~چ|vsy{n@4'd*‚f_L,̺z0]T,0]ٕј{OW߆2)Cend׃0l+#heCt"1D)V"#Jo>>M6u4rۑuz q-zP֌+}c#]YLK<oq_lvKdf_[ꇳ|V#>%MeSM||##F&O47HhcrNU":gY5:~Dtb9a ϼFn!?BT/&$˯˛v lU?bS;z}t|r=˘$8᭗ݪ~/ 4Q@H1$uZb>Q=鶚jU}銗Ɇwސ5!^)6 8]sjnF1Vy.‡Xt}W(o-^ʠ9;~~)mj^9~p0 ZGmodF@>K)yTI—PM5zz1ϟ3[ͺB,"?z7z󫭸 P3(hMUZ~o'Pk>dAyN Yw|ƫH?,n|ca2+=z0Wxjl^`:"ެc9?O^1iU8opQk1o+B[Z vu>fNFƿ¡'d~2\!վr -BV;t  N"lc9sׁskm58$ՙFIGgB18i}E2 Թ Of09J$"]S >h*[CA1e%udқA}[~ UVC pûo.ڤtu Bo:G_+`: jriy`}~50>:P(.d7V'<ϑdʠK;p8PdJoeWR5Txwh(\)๗ycaW&D r)ͦ2ܘ<ߒ>uE1G?m_|-wayR 5PFU˃ҶXݬlYg>*.uZh m"@S,ZaH#DIxi%|YC! !)9ݼ2VWJbR ⡥*(P1s[M =3zۅo`z02e) /Y !zfJK@V*h ݒa"S(E|KF5pWY J<[TדS\EQ4~DR܀F5sXR_jm}Y#[fTWFDo c]h~hI0fF꠼B)Jz(^z Pm7K= QaB聢,*Ia:dN1~Y^3Ư+M¤e3T0]J 5c1kNg՗^3Z\4w2L}EeliZ{s@d¼¼qsМ%"Ѫ7LtW/igJ! JT>'fʈŒA YX4qP|)wfM)Uk-%Lqj`g`OأevPAm6F۝}NFXZ2oJ4 E]SArጞS^wdjR?Y5Zzߙ_ȌKgsA_gp[!i7orc,("[@5, g xE#Ϩ或 hY뽄! dцM:X>͝ןx/0v['`fhv梭Q"a7,.]w 0Cuz3 ok1Z&ZWbY`QSayEG-i6̚ ɛJG"c0ߨa˅NCވ/LOMQ.uIɺ3Z8L!'"{ȌY c:$3Θ]FW𑨊Q?ڨqqh'!;Sku+`|l+͘::\a@']*_d,Sp|gnZ0E,Y) *Dâ;).E"Ly#xTҨ 2[׈h/1tFغ&1 8pG1ɺg+'ۉjnɁpFKwQ,6q>K{֘elxEm_/kT4?^UCC=g>^ )Ao]WE2a[̚{i\Q9i^0labR}}5)ЍWaguJ;bkd {WNF#ݬf߱FMvf kx}blZ33i'r!}ce]f^p71_K..d ,{J܃ `꼐V.LDU`~3,Vr.M\@,CQ̀p?8t8 f.[@ C mc+'V rc)pFr%[FZmD$yt7}KN_ދ2L0r\3-"ð u.E}q% {M;a5TQwzl5.=7MvCk$뿬vO08h2>CusGX6Z_a^NBgʶg&^Vf6p@(`ۍ$XmCwrN݂<0,@1*,yUW,9?L: gޒ#0$*T1 7߀.z$2iE~j"yJ8Q7 I j.3ՍN]x_̓Nk8d8taSw`Z;5E[~5D8jOB-H 0"X {AIFp3G +EEa) [Cq &ҊB^7.¥P s[R6dbG ƕ*~9|6yh[wnD:UkW~Ҋ] &sTt2|+:\{u1]J0/c{T)v;9)f8ɐ^VJ XeX1/l20a>ۚKLL8Љ~8܇`Rqe/lG;rW4oXEewIAqgMOdhs5{+ >~9~45'=6cfk.`6"~69Woۼ\[0QP.,;W] 0G* ?O4/x} 'of 4 }Yh>],=Cx􃪒BψapIՎom9Aɩ~Y?.N?7mfȢ@k\8֨^6 dD0.D{_]I֋RN^uuh(// d=zLs Sg _Y:ܩ@t֞{7RVzF&śߌU' 'ie^ly;1m׾;K~*NyD@O2;Tx2'd8U9SaFr8w+Kg7VؐfS;#n;eILkuh?ݖceľ1;".ZϪ`yJ QB7|{ʅpB[#p3/*"d?_Wv5ܹiD:fL_U,m u˫t-QcZX*9PHG;|d7Ĭ\CPR*6n: B6R Z?ൖޠg-6[Y]ڂcuqbgU bȦSW>g{v7Ž=>z:\9걌ya3J.W"]&g,_.CnT,:*NUVi{iϖ*Ekȧ t(TI9jOA"Jn=Rzq^"{$3_5-6۳90k,~!o^ha\3 HQMg& xd`k=lsx&GI1˜cl[Z43"h12IyZAm8",ˊ~QOZH/bk?q4!jIW:XS^C:FSwͶlֿ#?jz'yL^~7$k @taM5M^$лT D "; @]JED+H^̷9N ޙ3+.y ~ JlKXKS1$+Q-Z2ںi $Ҽ8ֻhVUx*|JcA|Q^D|U*l`DQN:f biiI;"BM:]mW~uB$~ <]`~AxFJ>ZiopR&Y XlGmO=m'!|jGE]bqZcf4`1U3vYTe:>ESÿ*z`Y~u7|4mJQfjbuZ G$Zʇ19"3@6"F>V2N9ĀuH7cB(W1T ghO4y]v4B9%ɚ#u.'D/Cxs\kdpE*?WCKq7X[1[k#4Q &J>U.<ͷG}(SOċ%KiȮ $!S{,T-e(=Z5{G=HgO?K9\.Tabq%>mSկ5*ծ9a ̴QhX&ˌ]EP~TD2r/_0in6 ~e$ }e4F=aV9nLN CH9^2$?GX.>1CȾhU+વtYkgXmnS(nk 'K88eY43[=NC}VmAhnV w%!!ml ?̒09kHm\(yF!3*ۉ[,QJ?AmN\?oUF|1e+&CeU#d+z^@=BsJa(tYa O!\]n8) 87lV6&C% -HD \#~&ftߩ@٢PST5Cysx`2,K֋_+N5TMLOKY'kGJs#GgCmnB^Hݶ`d}\,JQ0tg{YУ)^&;!e7$O_N{]6tX/E&]o=/-wF{"q5=wEU.1oI/qɴ:-N,[`41bd"q:":eLBV9yh!tZFIXhu LWB*t9~sձN`vBl@GP_:JE#aI!Bb>_cayVkXt ɋFɞߍܔm9+4o^)M}XRzO37J*BESrj0M|zwO ܩ/Fй!VGxCwc sLLFhc=׹"MU]T8 s&1f v@}"Zy6[Fspq;S^}eҿ,7ltKK-#ew~uIu딦G_q"KynBIvoà>-^7]uݪ#G)/NN$$s2"t$o3=htQ΀ߎM _FNJ?hħn6H)NJy!?PZ4\52d:ᧅ0Ux+,7,nD+*+>Gs`ɽ ':qX˼`_HC8M HfWj>BhS}T\ Ahچ#`alv$s&h)ZGO=(.оw,zv/*{3:B zŇö=MM6iY:~}XJOu6c`pJyG7^v)g~'t]%:ꇆ]ƣa7Wv42 j_>-PxH\d L=Rpc캇.55N?׻l Yr/z_n&cyY6O&'q >h{!~;ﴋ9=˅04C16[5ӠgmQV i-j.簵D࿄8 ɒLd{ےXj$_Gwhޗ Naw~U-5/k֩4ī p<ݣ u|Bq#AKVG.ҘwnxݖݞvG;PF5Q0PO-VF{f S?I@h8FV>.к ÑG\5DvGѤ94{OؙΖKsƽ(,;*د<;e櫓b<ÈƸO$?{?/Cƾ>=~x|#xs2uK^Ϲn+WZ@|,츺Sc⾯ND?Yt6XlcU [f>гUϲ7/,<^ѷgCekn|˽j7pY'5!Ù+>`;`dSՄ^8Pc؛n)\Ԥ#:fda7`kģ׳E Z0vq%a͌7[Gũ?FX)JǹyG+g5901[9ٟ4{A@r_5%c5$l}P}1F8"]sdW:a1_rDCsY"O&a:^>αIUf /4r.`}+/.p,f)GfV 6#?*hX2vLE/G/OY4SkJeLPPvyCrf?Rx 8LCs3%ՙ(\fVԝc:gU ,f:>N{)tî&Ӧ`!w꟏2m{TL֓gˇSi/6Gب.lo4X$>6~\lꌝTeG~`&wxe"S,+<Qie͇>QџqD}PT\)8Ҁj&vF<-߆-J/0LbO\Ux.Uss2,nG!.F)*#ye9^7+ \g9lxkW}]>!'x(KG^Վ48⿜t'uNk'jDq-$yCDFMR~[w.S/-OXĿ \W ݜ|]$L~BnyZ5uNɴw!],i\ru_h씲9OS~A7O=XnD 7]:Owyu79y^<jvɾGvCVۆT}oUSLI-,<.6ʤ>_(,2>;w{}%orl( Qߎ&ľyRBV4N2Mսs1g¦YEŖƟ$.:6-Ҷy_ (tqOrbdhO[uE+6(2 T}{v,xnVqDm܈h-Eͷ?TtKWi~MM1lۢ4E"wKbw[3KA+XPЄ嶥n!C3T}X9Obgb_G?}~u)RZM8՘'hݠAm3>yN2UXMgJ~eqY0k1Ŵt6FTY:[glaIhN5:x,^X VxdL׭#nQotYf7Ue}IeI=DqyG檶zRƘdCx}x`'{Dk'!7W s`Y < ֚L8Q|2&fG.zi5#/OACRL ̦LOf#k4 H9s;rT2WEF7u,?%KN1EEN $Kah޺bq{>1Q?&uYtă4x<2 >ug'J*@Y Kr3U,ghHn?tYB Cf%5FY!p ^Cdտxdf" n rN Zmq2Ƈw@~쳑j͏2GYu:H<ҍ*95^&d4kbnjKd帗r czmok hT6p_7]dOӣ5]u,kQ1G(0.ʄlhij`hMl55.`4xH/ٚbugo7,t`#u[ǦĺRsmvnFy0g'lD>EbUu @~؀I蟎~A)}}:.g؁;oBw@% Ȣci]b|wL~ɟB\X͑*' T#7>A|LYZ؊yֳpN"62) & \FYr;Hy+F{hX@p*sqV|MVd&t0L@MZe!ߴ ?r6uoǶN 9 ggKܲ=;|גn A|>Rx=;G;MΊ~Yc{ zvge~ArϠj،W2Acg)@d3z$^!زI79V `1MUx^a`oI.w8o?rXU01y=H~#n4(bD^kXzcmk}j ,WjZrJdYփw $^E[h܏rL}bͦa_.o2R_.IT~=~ʔc)T6} /$ tLG| [5'PcC<t3@E":Yjv/vTl 9C,2?4syKwxT,@ޔ?z;g!{|&ʏ낱O`QWSR.9Q_W^*#L>~ɼGɪ.nCƜ=Ny,A'tQ.úא#;2,p.z8:!fxL%&.9oR fܮ[)R 7%k*8U_azZnh[3e"%8:rOL,Ӹ#2f˛Qƅt3 'o}szm߬}GXVͺ 2V(sDѰT =L?Ep~2 mλ%h[Ck4Ϲ߰LXU9[? `{4Cʉb:^ ++SJӛ&F:Moor~HE)5 W[/-\ ]04q-}D13aLKĮ>m/ :̑Bn huD9]t8xH J`DUG왫aQIAz}?2uYLҴHݮ-W.k2[.l6=_$Uj&,H R[.|sr4֭M 0rM9Zٰ&hT^2ՠt]n tw$5%&.+<1tXwZE *gC_TѕΝNI3w;宧>RE Ɔ#W-dE L011S,٢wZɒW[nisIcDɋH0Kҳ¾ F-`#[je Jլe(G}v4L/p/i ɷ7/$g[J 87c=1AzΟޚlfEQm?VoR$-o38O}| N_@lr?HI?\N?Pkfw_r䃽8 .N֢z$(Nka_Eע|pK`իadB FV " &,Yz~eqzsVSތe :H7oS O4~r1"+owJ$ UL\i"{=Wt,2+mͧ(=xU %0i;qЈaplMY{bYjDT +]j,~aKoϩ_T)Coс-q"Z*s~. ϺiX[}gV;{eƵ+ųܖDk~98|w;Sم8:x=ExZ Q!+MiWa&ٳȻ]63c@\4}ŚGGw`{'t[Pt?!(dʓöůl8#!ua;)5ezEL?&-4p}ٹA~J?3:pax("6A~A~Eg7-)#ݶC[{0=,[>wUqA=loMNb\R<ѧxn]5.TƛI]'QXM}e# \]VKRvxi˜ |/]$S_,u3yߜxsW.)3fg)K\N9r]'Uwn؎r۽U}e_RL(89JՏUxtċ4L:9QîL9C_tbHOXK5.Q.7V%ݷf5E/M<դ`d͎؉j IYmUX5@{1xR|ȸb!kB{x'Qnb?W}TUbllЩBSL̟ גY7FO]gbk1loDbZ|qt݃z9v㬍C_=hH dd>.ꛔ1xWk>&oq`!; V>vl y]6غU41oIQ\0D?`yrf`jO; Ncn{V= }Hw-ƞ{re턞'{L~Xvzáiqtm{1j{a/c/ay-Ͻ#0]CjsfQtY3=$ބrlZ1/tGnV/޷G>2OTOi`wTymA{y z@wWҩ? sƝ3.琅n]ּ]뽡jוVF.oIfҿ}/,j9k? .Y'SC]4/l+9 ,7˷N|Lؤ?,LIQ%_<9%U3w?bji9=B#}a~?`y.ړX{5IYMM 'h;yaѳ=uxSY}YKJOjhahdnOf3MC eK:79 sIL~C8$BK{dU!QH~eC"=ɊT?.7qf7 uk chܧX OA<3dL)_q:Jw?IWKGbuwin_ e4(4qM;YkNɟZ<=Mz\"|_~g-( OPM31 @ZWDށ2pr;d ?5kLB6r.fY€gn:s.g#'U@Ma+E.z$x,x 1Chi5ܻMܫϣDX8ً/bNfwhz/ ԓ6d`e61fˌKd܅ =Vh跐SWpw€a-;q1u^3aYk3}ig'"ùI-bvmgVbăi)vG0H+IHݷg17:~5Bz1.nCk/+yV(9PKY{6>SgF54?mlŧl!|!+TKѦ)*^g~},n0$7azNAԗǝ=56t9A1"d(kq5.Zx#h3{o쉞/ѥKF&jt磮(ίE|⩻`@(0zdyc7_ֱ&!_h9Yx %]l9HhoFzt4^ZEtdrc}^C;LwJ옖rIVa7!7Bݢ]& f$JP$q]֡:Ѣ>doc FSwq'A9tH-T7 ţ0JO h}iaSA))? xmV5/>^zT0 Ek|s9<(E]7䂍pĹpÃ9oaxlM=8xZk8R. BdwFCmk2 "$xhuy}}q`9WN/RZޏViŁs;b}0:2D yJrs;{(Ā9- M!|FPN1OF&{l]5#sM&#YJ&u dg<t c W[|^B>ZVP>N4+^_Qdޠ{=%08>,>Ξ;S M:]\& [ko 8uOc5 IK* 'j3GMT x$X$ڷKnGu,YU6[-uׁy#C6*F"P~YW!޾j o0ÀޥD~y*Sj}?:̱tieIcY?^g=}Qij! ?7ƹ̋%6;SjȜaQY^sQxvaե`<\"%%sa셎*iQ?l,5Q7"aiב~*FnL"~=C#RcF;s-gbX+Z҂,ddqnqM!>'Λr/NdObEc:&;݇8O;o:7aAnoTm寂W+`ŔO12ƨz>2uĽd_oWo:LS{憚XAbXFs 2o)K|h/^t)iI7)4_`^hٯ;p].k^N3:/\sRR`; _OއK~2&>/7H-)mۈ9#^};c0];ZyA39=؎=_DZn^K_%ٵ8zNۋτgھ3!uy~sW IkώyH;7 On0ɟ6l%`lkurh],e:a/V\◻ꉯS9`G¦a9 2 5Xj6{ZG $*6/vjږ4YycF x~}gK!< Z[oSgiEWcq{hBZ CmT%na=$WaQQO>+3oN`vQgL1'! V]9fΜ_WtIS]?Tge困n^Q@{AvIZ)yWi2*7r+{a~h˗9Kc/@ ٵ7Fr@ xTƆ3h7{\ /;>5qtJ0_R*; Eb~Jԯ\&LL.L!A=҉Ϧ=Jg{|0US#i6Q+إh2zQ)aN[L̂=&j˷ BoC@xؙx^*9Juٞ_:^sJ$n7]^Ʌ)DPFȿ=閞 Hc,D=jK}-ƕ{yan/Y4dC뻾Lgs8L)44?~$ $PȒk*ƌ JHF)ѐxU7 86%$U=X~Tuı*92V%|dƽY祃0 g꾮LұGl~h:dLhiZ[U.!`GzswTnL[ f+OZ,ѾzpA;?pi\K8\̐}}}zja|4Ot㟬M;%%vľIԷ?U0+DڅTLI1=՛I?SS  _9aΪ Lv=[I0FS~i M*[c:mbjfpW}k\xϟ)|*|^ΏyP<'Y_vy;?<-'Qpc;Z4XJo,o4?Wj HWQFCjf^e),J a@^ehJ FdP-1~{y?,'ri&y) Z7-g|(5ErXH xS~5@<:{"4kG,u?XIç)5nhs՟?4wT2JC)h,"ԭcM| [gHj^`%w#3kx32&l@z9ܩYC&d ~'QiU+fyB7/Dz0GÏD]J})y>@04اv}$?Uh=J%t{/ 1j5Ň u>O/N~sa%eAE?s9~e':X Dol 3 2lb5#;[HG\6;ó>n6zKMrm[‚t'X -]T@!=5h(CPZhz` %dC|`{gزCs jxO 3cN,dcXo!:8JE|j׋BzZ7'͛F,'dg1 O:9h^3w)w2HL<t +yHu.ډ0\ZBrs3ޫ.6k-uy.Jf?'@{; g-iۮ.OUNeųiRO ~(Sp/\MW(YL!:iJ&RA4yoD|F|lE|]b_VmΝr'A zO38xȞ*!țyc#O88Y- 1MI:]M>0_0|7o|ǹ8Zvj=cCf~VrMj) GR6-yz{n [sSPx \Ӽ$5n!|+*DQ?Es.C0?`؝S־ Z00;%d݀7Ɖ^wܙY Ic瑷 xlwp \aIsO>ӆIeSC#1zo`hth xM[|DM\"[hr]^cA !ʊ"ҝ0/o+On/Sرh>f]9 eZ'f*#b{<fFwĤr?@ D! D ^ EJ?.܈TA}Q_A݅oUoEɪ?2/{a W1JMiZlbF:T(n#E(HO'ʫ۪GL1-OS(=jWB<[pjı܁TbvqݖCy_&^*7fXC*f(ƷKsv-w?5>l ;gO$2-*o7KHaXe#z@c}NV/HΪӆ]GC׫\_ԙvyKItΫڻ/WB `/zfRßX.7vUp(f PTwY{ؠ:G-(jVzEUQEG޽x. ho0_c]v%* Of;>OQïwaGuntH{Q_q$p#hW9u^_Z4ǥ6:YS'Z|;y:T1?MsF'5;jV].'w9'-#^>L&{ 2UI-Rh6,\,xb, m8v/}̂Q.c?uW_>jC'¹8nPDft+e ،8UiOg{dGxfBt0¶4j r'z̄$b%Qx?nQ}"C?ZS;<ÌnͪsĘ%SmgRɘ: Qyk:Ht~/[+Ku߇]W~f&M Y=➳cry{hiK[!*!!TFC,J%-iHJDdg}%RFv߹{s=wۄDbP2olk&8GNuzK%mwjbK^QJV~2'%_Ϥ;{#כόɭʤh_ ONOj00;bjz1D ^V++#<]Qt+6cy1:)~sH%7dk^#&vvx>33Yp9 /5wv @B 4<1J\W.C.ű$s8R2/Z6k 6s!=7yN*,=WOH۝{` WeHC ckh83o9{ d>_8?MvZpK y#(N0q}7Jg^Jy\-R>z}!ܙ+_ ;:,7$RBMy)|˖w+EUV_JrW'lCC(Pwd~!;Zl:c(iˬos>>՟;~bQ/O;t%{ ?:8ɿ +#а$ sGx?nr9~{8>ηdzw-b"Āۼ0oB| tzCQh y׆(<"xw[1ӿȯW3ң yߚiI=%}Wnā@zO@R.Ƈ5Y>Ѫ={h@A/Ȼ8MaB_*}v7q>:~n a)CA L%)C WRpe'ҷŴ㧤r|c:Z{1߅|^VWCTZ^YqhϷ_֎/RY?;zvt1}H~}!)nA8:I&e<KF<]#tH>fE{` +AtJo< =YY vdo'v)cفG>m\UVu6-f:Z~`[ Z ܞ2Z4_;UX-,bQnWpտn8|W:u%p|L)C,ޏSH.lCD!x!GmA>Y* Ild6^RM;7PDիm#jcň ԣ%P&DcjPחH$&9Q;<B4V&D}KXOH|Fg0!*[y(>]<+w$YƏ\;+K.loJ&8;~P+DqwA"yR$R& Mf e:vZ\q 1TQEz,B}vDZm Q'h$Dhs w$IqaR?qG+M  |uBToV ݺ)=C_d2R(0Ph']jHG֟w2H+G(r(7mʫL}rKX IA+il'f{/;UOKDȫ _1]xQwHy.hK7v02ip7-#W w_-%CBD-Dco/_R5, P吓ir,8F9ǛTq!y͹p*xJ]$lĽXtפbw>ȗw*eZWs#_N ~bx]D00O5>jjm.|W߈Үo1oPdK}n߷j?LAd'5$](~<){խ<z*76LS'MB1DN%~{ъ#f!J|"1[W[Xjvvgoݦ9+ ѻ,Q ősw V`[^_H2ZQOs{vR(҄}RU)!z` ޥH~sݨDxH"wդ?qMn SGXI_=xh>aJm(gΪ+'IPI~؀ub[o:[HWӄH[~uu:'C+3p<VOw|G<< 5|*߈l#7:e[ $\v{7y"[a~+e򉿍MT7I BkegThb"p@>)?FJ艐r{uRZe6X]@:LokjO-6FPbZ'@\ռ#|W ^El\:nxqB׆Y5*߹<4 * > d ?H`F "[+K'lH;>f=|HU8i^\#&d%ZVOQ.h=4~%fl0.K)0~Q5&a{ yqMa7CG?wx+f"Y*_ʻT)%#J)&seOwIɪ]uw,kח I6Ocw&xbU7v@"st:}Q?G-^*s`oX Io\Wkw7R|}eV1VAyu&FZ?!~&H"}pr ӕFgE},J4O9; eu^gJW9DqkR*rq[ZSRoT,ea?tQ*fk+ޭ.G^6hh!GF&h[2{ko' Sz W DO'H@/ҝO qys;/Lvੳ?+{Z'xhnHFWcKt kzQ4ԑs82U7~9n 86 _kfEs yY->W_92};Y#Qz-T&g)\-a}kjyD᜹}0T#A,*=K7+btpv#~ˢ磥lz_ %Yv B'9-gHurwwY4wy{\Б9Ebdׇ_H<)O}+'hG3 ^OuW9 6#UikJ\=m/#d᫭{|96?HupGt -ʣ$Lh1Fď޻[{xnҫU>仂ܨ]Οg+n7 vsO~{N{'xFqND!*,4N8BQagP@7f^"ڶ~%1L}jM2&jC1DsIf[(pҒOyF}zó[erz]5opm5iԨ\nD^b5#oD"2Wt֑KBߐ 7<=#y"V8 b"j.X~wA m9[n;YH܆K0ty?$dCK-OK|e %!]ܓ)٧tdeɕh,t.8׵di8qsYAǯHqEӬVV͆/[%4`ChS6Ve }ך<8%.PTܝݏKSbى +)6I;ܹ-Ȃ9 A# MCjh=vbnu/Ctz1ーxbZv l8\MC(-NE-sX~j]@n*Yȯō 쌦[.|;\[8U9A3|,T|r W(_`Yf 5Ψ^ 9_0ڮh`ԷHj?D=lFdבȏ50~8Z!0lm#@l~Mz!_?mf(r+X?}- O%eyeSNjXlk:װ0&0݁}BUZ\Æ> @)YP/:?t0YşQkw.з>b_5揣d̤8 0[P<^2 -C+sH.-c=i%?!Y]dyK2pRjo8A,b~0#:{5:J C9>ȇr AbVM=ф,*Yޤ~i_8nоXK\&A%OC΂2(J-?thHe!]ƒ QeۍW#7`I$/"_[Vit&[N&iJm0]͟tUJS5&f*'e2^PTOН} g~!SxҤI%BW7HwsŽƄyL q };m! "D\ue!YRm&s'r\$/@G4Wpб-p9DoK:,GMJz,m-HRRZH"dZHUB4+74f+zQ.R"i~Dd# !Jt>7_T@!!n(kEOYk7V95V'q,/!ߠ-1)i6CEY|䏵U݇\],Fkf@$9 䋓Ga!ZN'ȗ:xtY\!}Er.O c4rp-n:ѺnGGȻGӿTv){;?uu.n'Cr[BuROo#9>/K P_4p/?RsuBm8M-쾊eK_|٨$x,q}} eG퍙kBT~ wAzӖady/_:PG_G8Z0R ;(z>i,/ݒ'l8,Aqe_UyzuY[rrEJ;2Po 2 v*]o$"_S!7zVlF|+|>w nϑ;uHE|=;|l/ϫ;?]{@!)G^*Oa0H \К{\Hyha(tZN-']uVj8u] h/e8/xc<ѐ u1GZ O=8IGU|QO<ʝIqbBfq λ6K,O~q{ۑ|oFS+`<;پƃx3z/Xr..gq+߿ MG9o F| =#sGԬX#}KPB7.x{47u+֑q/%Dћ+PDJnΈׂiUdy1?iv_*b/\Wmx5ؐ?ӕnAk{=8Ez!HwD.;yZPߋc -E0?)qrRηs`sHh9U@q7uZ'y03p[ˏq̗6augHltfD_ft\epl Cxnj*'o~Vpl3eq0ҍ߲槴-ՅEeO]9S;tJ Q1h$R4BFv "-ApC (^gc3Qt>gPn ;Ot85!? Kmcaƙ.VY?,)H$ 3at.?9x N♃M6 _3HA\s^aV+Q-_[b]j'iF2o3\/H') _;-F> +.wϻlQnkL3ٞdڀ%;*xgnxٗClFO-%ntc9<򊻦䳲m#7so u3볭3=@"[l9?0`vՠځqHǣ =˕0,8b@.#6gzLiL&D^uϜypw)0uހ R3<;ʙa6hz9ݺqz@5@q4x+lF},2썚>/IM}t{дLwX-GNF!&@A5pt@Ԃ{pMdoIpB7<w,HO}B_xP_mE Oot3pDtaoi漓4o{HߓeFZ7.Eaİ؉_w֮a)q!Fh3޸ 1,Ga|Vi=:0jXX;i"?4wSawlPEnNɎ~ģܨhڼ.4[5d;ؙnN_o w@t;ʿyNы#$Uz";?-7 }3լA-wg&~:OVIB;g)Xx',O* W<ڊ9i1[܌tGмۑE(gj:=Wu'O%u}oV87F6Amod0dщ]s$iᡘQŁ5Wh}eAM) !g=9蘙dVÎmbYJ=Ю{rfc݂. Pr} 2s *q'eHDWڝi>fӍ4O [}YCh~rAIZZ.f'gl̿Ǫk&Y^c!c6.hlW0C ]WńQƔ78@͊*w\:kSccveШ|z Lڐua 9\p,꾻ʽzvSҫX4}SQy7s_47d״KF{\+l_T?_$`yX=pɈyě 7Yr}0b )B>_CtjȠү?N`*7_;Mee%~1X3Q"1E܉w _DS1ao qwΪi{B6Ђd'3'Yc[Lp|X:-۾8Cy6 |x+ˠ9zG8f#:m#DO=޲hdS뿾d׾0$ѢpT%[E<|S\sfre|]c=>WYxС7)M@9pK8p}(GSf =~U$-9"Is\!M» 6#g3ٹT$jvB}/n[+i&ml-+ʠS*eyZzj>˦ms9˫ˎp09(vvzgk<\<ބJb_e6G_䐏7usFKm$8 ʽa2|m,VGX %ZQmgDgDr0eh2ÿskZ;5U$~Li1zN%_FrE 1U.!D^[Nm r\A˳" ֦0SJ9(pܷbeE@q]4h}R.>qiwc3L{pĵ&| ao|Z 2=(m!7PH:,^jb?5SP4 [Bo0^'zyx;Iuh[vJ~4!2-HrX+XȧR]8><C^󺯴qD5Vs^(hJКKq\w>90G\/0O’$AJXJ{#r1Z ]o>Tl" S"_Ԏ٢_H$*7$S]o߀H%Dg~=7(ϡDC)%9>]ao'IY+&:x#(+VԎ`5-uPו p|;Fg+?7\Bv!ݧW~A>w򽄯C íbk9xvcG"F;%p H>H,2J@z^qQ,3\z`Dc|